Current position:Product Center > Cell lines > TAA > CEACAM > Cynomolgus_CEACAM7 CHO-K1 Cell Line
Cynomolgus_CEACAM7 CHO-K1 Cell Line
Product Info

Cat. No:GM-C26051

Product:Cynomolgus_CEACAM7 CHO-K1 Cell Line

产品配图.jpg

Materials required

Cell Growth Medium:F12K+10% FBS+1% P.S+4 μg/mL Puromycin

Cell Freezing Medium:90% FBS+10% DMSO

Description

Cynomolgus_CEACAM7 amino acid sequence (A0A2K5VAB7):

MGSPSACPHRACIPWQGLLLTASLLTFWNLPTSAQTNIEVVPFNVAEGKEVILLVSNVSRNLYGYNWYKGERVHANYRIIGYVTQENAPGPAHSGRETIHRNGSLLIQNVSLSDPGIYTLHVISEDLVTEEVTRQFYVFLEPPKPSISSNTFNPVENKDIVALTCQPETQDTTYLWWVNNQSLQVSPRRLLSVDNRTLVLLSITTNDKGPYECEIQNPVGARRSDPVTLNVRHESVPGSSPDLSAGTAVSIMIGVLAGMALI

Data
Message Consultation
If you have more questions, please fill in the relevant information,we'll respond as soon as possible to assist you!
Reset
Submit
You can also contact us on the Scientist and Science Exchange marketplaces.
Current Position:Product Center > Cell lines > TAA > CEACAM > Cynomolgus_CEACAM7 CHO-K1 Cell Line
classify
Cynomolgus_CEACAM7 CHO-K1 Cell Line
Product Info

Cat. No:GM-C26051

Product:Cynomolgus_CEACAM7 CHO-K1 Cell Line

产品配图.jpg

Materials required

Cell Growth Medium:F12K+10% FBS+1% P.S+4 μg/mL Puromycin

Cell Freezing Medium:90% FBS+10% DMSO

Description

Cynomolgus_CEACAM7 amino acid sequence (A0A2K5VAB7):

MGSPSACPHRACIPWQGLLLTASLLTFWNLPTSAQTNIEVVPFNVAEGKEVILLVSNVSRNLYGYNWYKGERVHANYRIIGYVTQENAPGPAHSGRETIHRNGSLLIQNVSLSDPGIYTLHVISEDLVTEEVTRQFYVFLEPPKPSISSNTFNPVENKDIVALTCQPETQDTTYLWWVNNQSLQVSPRRLLSVDNRTLVLLSITTNDKGPYECEIQNPVGARRSDPVTLNVRHESVPGSSPDLSAGTAVSIMIGVLAGMALI

Data
Message Consultation
If you have more questions, please fill in the relevant information,we'll respond as soon as possible to assist you!
Reset
Submit
You can also contact us on the Scientist and Science Exchange marketplaces.
Message consultation
reset
submit
Service
Message
Message consultation
reset
submit