Current position:Product Center > Cell lines > Immune checkpoints > HAVCR2(TIM3) > Cynomolgus_HAVCR2(TIM3) CHO-K1 Cell Line
Cynomolgus_HAVCR2(TIM3) CHO-K1 Cell Line
Product Info

Cat. NoGM-C25909

Product:Cynomolgus_HAVCR2(TIM3) CHO-K1 Cell Line


产品配图.jpg


Materials required

Cell Growth Medium:F12K+10% FBS+1% P.S+4 μg/mL Puromycin

Cell Freezing Medium:90% FBS+10% DMSO

Description

 


Cynomolgus_HAVCR2(TIM3) Amino acid sequence :

MFSHLPFDCVLLLLLLLLTRSSEVEYIAEVGQNAYLPCSYTPAPPGNLVPVCWGKGACPVFDCSNVVLRTDNRDVNDRTSGRYWLKGDFHKGDVSLTIENVTLADSGVYCCRIQIPGIMNDEKHNVKLVVIKPAKVTPAPTLQRDLTSAFPRMLTTGEHGPAETQTPGSLPDVNLTQIFTLTNELRDSGATIRTAIYIAAGISAGLALALIFGALIFKWYSHSKEKTQNLSLISLANIPPSGLANAVAEGIRSEENIYTIEEDVYEVQEPNEYYCYVSSGQQPSQPLGCRVAVP

Data
Message Consultation
If you have more questions, please fill in the relevant information,we'll respond as soon as possible to assist you!
Reset
Submit
You can also contact us on the Scientist and Science Exchange marketplaces.
Current Position:Product Center > Cell lines > Immune checkpoints > HAVCR2(TIM3) > Cynomolgus_HAVCR2(TIM3) CHO-K1 Cell Line
classify
Cynomolgus_HAVCR2(TIM3) CHO-K1 Cell Line
Product Info

Cat. NoGM-C25909

Product:Cynomolgus_HAVCR2(TIM3) CHO-K1 Cell Line


产品配图.jpg


Materials required

Cell Growth Medium:F12K+10% FBS+1% P.S+4 μg/mL Puromycin

Cell Freezing Medium:90% FBS+10% DMSO

Description

 


Cynomolgus_HAVCR2(TIM3) Amino acid sequence :

MFSHLPFDCVLLLLLLLLTRSSEVEYIAEVGQNAYLPCSYTPAPPGNLVPVCWGKGACPVFDCSNVVLRTDNRDVNDRTSGRYWLKGDFHKGDVSLTIENVTLADSGVYCCRIQIPGIMNDEKHNVKLVVIKPAKVTPAPTLQRDLTSAFPRMLTTGEHGPAETQTPGSLPDVNLTQIFTLTNELRDSGATIRTAIYIAAGISAGLALALIFGALIFKWYSHSKEKTQNLSLISLANIPPSGLANAVAEGIRSEENIYTIEEDVYEVQEPNEYYCYVSSGQQPSQPLGCRVAVP

Data
Message Consultation
If you have more questions, please fill in the relevant information,we'll respond as soon as possible to assist you!
Reset
Submit
You can also contact us on the Scientist and Science Exchange marketplaces.
Message consultation
reset
submit
Service
Message
Message consultation
reset
submit