News
Current position:Product Center > Cell lines > Immune checkpoints > CD276(B7H3) > Cynomolgus_CD276 CHO-K1 Cell Line
Cynomolgus_CD276 CHO-K1 Cell Line
Product Info

Cat. No:GM-C23914

Product:Cynomolgus_CD276 CHO-K1 Cell Line


产品配图.jpg

Materials required

Cell Growth Medium:F12K+10% FBS+1% P.S+4 μg/mL Puromycin

Cell Freezing Medium:90% FBS+10% DMSO

Description

A monoclonal cell line stably expressing Cynomolgus CD276 was established using lentiviral technology based on CHO-K1 cells.


Cynomolgus_CD276 Amino acid sequence:

MLHRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFLDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSITITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFLDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLVALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQELA

Data
Related Products
Get A Quote
HER3(ERBB3)
Cynomolgus_ERBB3(HER3) CHO-K1 Cell Line Cynomolgus_ERBB3(HER3) HEK-293 Cell Line H_ERBB3(HER3) CHO-K1 Cell Line
H_ERBB3(HER3) HEK-293 Cell LineH_ERBB3(HER3) MC38 Cell LineMouse_HER3(ERBB3) CHO-K1 Cell Line
Anti-ERBB3(HER3) hIgG1 Reference Antibody(Patribio)Anti-H_ERBB3(HER3) hIgG1 Antibody(Barecetamab)Anti-H_HER3 hIgG1 Antibody(Patritumab)
Human HER3 Protein; His Tag

C-MET:HGF
H_cMET KO HEK-293 Cell LineH_cMET: cMET Dimerization U2OS Cell LineCynomolgus_cMET CHO-K1 Cell Line
H_cMET CHO-K1 Cell LineH_cMET HEK-293 Cell LineH_cMET HEK-293(cMET KO) Cell Line
Anti-H_HGFR(Met) hIgG4 Antibody(Emibetuzumab)

CD276(B7H3)
H_CD276(B7H3) CHO-K1 Cell Line

Anti-CD276(B7H3) hIgG1 Reference Antibody(Ifibio)

Biotinylated Human CD276(B7H3 2Ig) Protein; His-Avi TagBiotinylated Human CD276(B7H3 4Ig) Protein; His-Avi TagHuman CD276(B7H3 2Ig) Protein; His Tag
Human CD276(B7H3 4Ig) Protein; His Tag

TROP2(TACSTD2)
Cynomolgus_Trop2 CHO-K1 Cell LineCynomolgus_TROP2 HEK-293 Cell LineH_TROP2 CHO-K1 Cell Line
H_TROP2 CT26 Cell LineH_TROP2 HEK-293 Cell LineH_TROP2 LLC1 Cell Line
H_TROP2 MC38 Cell Line

Anti-H_TROP2 hIgG1 Antibody(Datopotamab)Anti-TROP2 hIgG1 Antibody(Hu2G10-5)Anti-Trop2 hIgG1 Reference Antibody (Sacbio)
Anti-Trop2 hIgG1 Reference Antibody(Datbio)

Anti-Trop2-DXD ADC(Dar4)[Datopotamab deruxtecan,Dato-DXD]Anti-Trop2-SN38 ADC(Dar8)[Sacituzumab govitecan]
Human TROP2 Protein; His Tag

ADC Related Product
Anti-DXD Mouse IgG1 Antibody (23E21C5)Anti-DXD Mouse IgG1 Antibody (4A5A12)Anti-Dxd Mouse IgG2a Antibody (17D6A4)
Anti-Eribulin Mouse IgG2a Antibody (10F8G4)Anti-MMAE Mouse IgG1 Antibody (11C10E3)Anti-MMAE Mouse IgG2a Antibody (17A1K11)
Anti-MMAE Mouse IgG2a Antibody (8F6A3)Mouse anti Human IgG-MMAE(Dar4)
Human IgG1 Isotype-DXD (Dar8)Human IgG1 Isotype-Eribulin (Dar4)Human IgG1 Isotype-MMAE (Dar4)
Recombinant DT3C Protein

Message Consultation
If you have more questions, please fill in the relevant information,we'll respond as soon as possible to assist you!
Reset
Submit
You can also contact us on the Scientist and Science Exchange marketplaces.
Current Position:Product Center > Cell lines > Immune checkpoints > CD276(B7H3) > Cynomolgus_CD276 CHO-K1 Cell Line
classify
Cynomolgus_CD276 CHO-K1 Cell Line
Product Info

Cat. No:GM-C23914

Product:Cynomolgus_CD276 CHO-K1 Cell Line


产品配图.jpg

Materials required

Cell Growth Medium:F12K+10% FBS+1% P.S+4 μg/mL Puromycin

Cell Freezing Medium:90% FBS+10% DMSO

Description

A monoclonal cell line stably expressing Cynomolgus CD276 was established using lentiviral technology based on CHO-K1 cells.


Cynomolgus_CD276 Amino acid sequence:

MLHRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFLDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSITITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFLDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLVALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQELA

Data
Related Products
Get A Quote
HER3(ERBB3)
Cynomolgus_ERBB3(HER3) CHO-K1 Cell Line Cynomolgus_ERBB3(HER3) HEK-293 Cell Line H_ERBB3(HER3) CHO-K1 Cell Line
H_ERBB3(HER3) HEK-293 Cell LineH_ERBB3(HER3) MC38 Cell LineMouse_HER3(ERBB3) CHO-K1 Cell Line
Anti-ERBB3(HER3) hIgG1 Reference Antibody(Patribio)Anti-H_ERBB3(HER3) hIgG1 Antibody(Barecetamab)Anti-H_HER3 hIgG1 Antibody(Patritumab)
Human HER3 Protein; His Tag

C-MET:HGF
H_cMET KO HEK-293 Cell LineH_cMET: cMET Dimerization U2OS Cell LineCynomolgus_cMET CHO-K1 Cell Line
H_cMET CHO-K1 Cell LineH_cMET HEK-293 Cell LineH_cMET HEK-293(cMET KO) Cell Line
Anti-H_HGFR(Met) hIgG4 Antibody(Emibetuzumab)

CD276(B7H3)
H_CD276(B7H3) CHO-K1 Cell Line

Anti-CD276(B7H3) hIgG1 Reference Antibody(Ifibio)

Biotinylated Human CD276(B7H3 2Ig) Protein; His-Avi TagBiotinylated Human CD276(B7H3 4Ig) Protein; His-Avi TagHuman CD276(B7H3 2Ig) Protein; His Tag
Human CD276(B7H3 4Ig) Protein; His Tag

TROP2(TACSTD2)
Cynomolgus_Trop2 CHO-K1 Cell LineCynomolgus_TROP2 HEK-293 Cell LineH_TROP2 CHO-K1 Cell Line
H_TROP2 CT26 Cell LineH_TROP2 HEK-293 Cell LineH_TROP2 LLC1 Cell Line
H_TROP2 MC38 Cell Line

Anti-H_TROP2 hIgG1 Antibody(Datopotamab)Anti-TROP2 hIgG1 Antibody(Hu2G10-5)Anti-Trop2 hIgG1 Reference Antibody (Sacbio)
Anti-Trop2 hIgG1 Reference Antibody(Datbio)

Anti-Trop2-DXD ADC(Dar4)[Datopotamab deruxtecan,Dato-DXD]Anti-Trop2-SN38 ADC(Dar8)[Sacituzumab govitecan]
Human TROP2 Protein; His Tag

ADC Related Product
Anti-DXD Mouse IgG1 Antibody (23E21C5)Anti-DXD Mouse IgG1 Antibody (4A5A12)Anti-Dxd Mouse IgG2a Antibody (17D6A4)
Anti-Eribulin Mouse IgG2a Antibody (10F8G4)Anti-MMAE Mouse IgG1 Antibody (11C10E3)Anti-MMAE Mouse IgG2a Antibody (17A1K11)
Anti-MMAE Mouse IgG2a Antibody (8F6A3)Mouse anti Human IgG-MMAE(Dar4)
Human IgG1 Isotype-DXD (Dar8)Human IgG1 Isotype-Eribulin (Dar4)Human IgG1 Isotype-MMAE (Dar4)
Recombinant DT3C Protein

Message Consultation
If you have more questions, please fill in the relevant information,we'll respond as soon as possible to assist you!
Reset
Submit
You can also contact us on the Scientist and Science Exchange marketplaces.
Message consultation
reset
submit
Service
Message
Message consultation
reset
submit