Where Discovery Begins
Cynomolgus_CD276 CHO-K1 Cell Line
Cat. No.
GM-C23914
Size
2 vial
Quote
Product Info
Data display
Materials required
Description
Related products
Product Info

Cat. No:GM-C23914

Product:Cynomolgus_CD276 CHO-K1 Cell Line


产品配图.jpg

Data display
Cynomolgus_CD276 CHO-K1 Cell Line was determined by flow cytometry using Anti-CD276(B7H3) hIgG1 Reference Antibody(Ifibio) (Genomeditech/GM-87345MAB).
Materials required

Cell Growth Medium:F12K+10% FBS+1% P.S+4 μg/mL Puromycin

Cell Freezing Medium:90% FBS+10% DMSO

Description

A monoclonal cell line stably expressing Cynomolgus CD276 was established using lentiviral technology based on CHO-K1 cells.


Cynomolgus_CD276 Amino acid sequence:

MLHRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFLDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSITITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFLDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLVALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQELA

Related products
HER3(ERBB3)
Cynomolgus_ERBB3(HER3) CHO-K1 Cell Line Cynomolgus_ERBB3(HER3) HEK-293 Cell Line H_ERBB3(HER3) CHO-K1 Cell Line
H_ERBB3(HER3) HEK-293 Cell Line H_ERBB3(HER3) MC38 Cell Line Mouse_HER3(ERBB3) CHO-K1 Cell Line
Anti-ERBB3(HER3) hIgG1 Reference Antibody Anti-H_ERBB3(HER3) hIgG1 Antibody Anti-H_HER3 hIgG1 Antibody
Human HER3 Protein; His Tag    
C-MET:HGF
H_cMET KO HEK-293 Cell Line H_cMET: cMET Dimerization U2OS Cell Line Cynomolgus_cMET CHO-K1 Cell Line
H_cMET CHO-K1 Cell Line H_cMET HEK-293 Cell Line H_cMET HEK-293(cMET KO) Cell Line
Anti-H_HGFR(Met) hIgG4 Antibody    
CD276(B7H3)
H_CD276(B7H3) CHO-K1 Cell Line    
Anti-CD276(B7H3) hIgG1 Reference Antibody    
Biotinylated Human CD276(B7H3 2Ig) Protein; His-Avi Tag Biotinylated Human CD276(B7H3 4Ig) Protein; His-Avi Tag Human CD276(B7H3 2Ig) Protein; His Tag
Human CD276(B7H3 4Ig) Protein; His Tag    
TROP2(TACSTD2)
Cynomolgus_Trop2 CHO-K1 Cell Line Cynomolgus_TROP2 HEK-293 Cell Line H_TROP2 CHO-K1 Cell Line
H_TROP2 CT26 Cell Line H_TROP2 HEK-293 Cell Line H_TROP2 LLC1 Cell Line
H_TROP2 MC38 Cell Line    
Anti-H_TROP2 hIgG1 Antibody Anti-TROP2 hIgG1 Antibody Anti-Trop2 hIgG1 Reference Antibody
Anti-Trop2 hIgG1 Reference Antibody    
Anti-Trop2-DXD ADC(Dar4) Anti-Trop2-SN38 ADC(Dar8)  
Human TROP2 Protein; His Tag    
ADC Related Product
Anti-DXD Mouse IgG1 Antibody Anti-DXD Mouse IgG1 Antibody Anti-Dxd Mouse IgG2a Antibody
Anti-Eribulin Mouse IgG2a Antibody Anti-MMAE Mouse IgG1 Antibody Anti-MMAE Mouse IgG2a Antibody
Anti-MMAE Mouse IgG2a Antibody Mouse anti Human IgG-MMAE(Dar4)  
Human IgG1 Isotype-DXD (Dar8) Human IgG1 Isotype-Eribulin (Dar4) Human IgG1 Isotype-MMAE (Dar4)
Recombinant DT3C Protein    
For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.
Cynomolgus_CD276 CHO-K1 Cell Line
Cynomolgus_CD276 CHO-K1 Cell Line
Cat. No.
GM-C23914
Size
2 vial
Quote
Product Info
Data display
Materials required
Description
Related products
Product Info

Cat. No:GM-C23914

Product:Cynomolgus_CD276 CHO-K1 Cell Line


产品配图.jpg

Cat. No:GM-C23914

Product:Cynomolgus_CD276 CHO-K1 Cell Line


产品配图.jpg

Data display
Cynomolgus_CD276 CHO-K1 Cell Line was determined by flow cytometry using Anti-CD276(B7H3) hIgG1 Reference Antibody(Ifibio) (Genomeditech/GM-87345MAB).
Materials required

Cell Growth Medium:F12K+10% FBS+1% P.S+4 μg/mL Puromycin

Cell Freezing Medium:90% FBS+10% DMSO

Cell Growth Medium:F12K+10% FBS+1% P.S+4 μg/mL Puromycin

Cell Freezing Medium:90% FBS+10% DMSO

Description

A monoclonal cell line stably expressing Cynomolgus CD276 was established using lentiviral technology based on CHO-K1 cells.


Cynomolgus_CD276 Amino acid sequence:

MLHRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFLDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSITITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFLDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLVALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQELA

A monoclonal cell line stably expressing Cynomolgus CD276 was established using lentiviral technology based on CHO-K1 cells.


Cynomolgus_CD276 Amino acid sequence:

MLHRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFLDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSITITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFLDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLVALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQELA

Related products
HER3(ERBB3)
Cynomolgus_ERBB3(HER3) CHO-K1 Cell Line Cynomolgus_ERBB3(HER3) HEK-293 Cell Line H_ERBB3(HER3) CHO-K1 Cell Line
H_ERBB3(HER3) HEK-293 Cell Line H_ERBB3(HER3) MC38 Cell Line Mouse_HER3(ERBB3) CHO-K1 Cell Line
Anti-ERBB3(HER3) hIgG1 Reference Antibody Anti-H_ERBB3(HER3) hIgG1 Antibody Anti-H_HER3 hIgG1 Antibody
Human HER3 Protein; His Tag    
C-MET:HGF
H_cMET KO HEK-293 Cell Line H_cMET: cMET Dimerization U2OS Cell Line Cynomolgus_cMET CHO-K1 Cell Line
H_cMET CHO-K1 Cell Line H_cMET HEK-293 Cell Line H_cMET HEK-293(cMET KO) Cell Line
Anti-H_HGFR(Met) hIgG4 Antibody    
CD276(B7H3)
H_CD276(B7H3) CHO-K1 Cell Line    
Anti-CD276(B7H3) hIgG1 Reference Antibody    
Biotinylated Human CD276(B7H3 2Ig) Protein; His-Avi Tag Biotinylated Human CD276(B7H3 4Ig) Protein; His-Avi Tag Human CD276(B7H3 2Ig) Protein; His Tag
Human CD276(B7H3 4Ig) Protein; His Tag    
TROP2(TACSTD2)
Cynomolgus_Trop2 CHO-K1 Cell Line Cynomolgus_TROP2 HEK-293 Cell Line H_TROP2 CHO-K1 Cell Line
H_TROP2 CT26 Cell Line H_TROP2 HEK-293 Cell Line H_TROP2 LLC1 Cell Line
H_TROP2 MC38 Cell Line    
Anti-H_TROP2 hIgG1 Antibody Anti-TROP2 hIgG1 Antibody Anti-Trop2 hIgG1 Reference Antibody
Anti-Trop2 hIgG1 Reference Antibody    
Anti-Trop2-DXD ADC(Dar4) Anti-Trop2-SN38 ADC(Dar8)  
Human TROP2 Protein; His Tag    
ADC Related Product
Anti-DXD Mouse IgG1 Antibody Anti-DXD Mouse IgG1 Antibody Anti-Dxd Mouse IgG2a Antibody
Anti-Eribulin Mouse IgG2a Antibody Anti-MMAE Mouse IgG1 Antibody Anti-MMAE Mouse IgG2a Antibody
Anti-MMAE Mouse IgG2a Antibody Mouse anti Human IgG-MMAE(Dar4)  
Human IgG1 Isotype-DXD (Dar8) Human IgG1 Isotype-Eribulin (Dar4) Human IgG1 Isotype-MMAE (Dar4)
Recombinant DT3C Protein    
Contact
Us
Message Inquiry
reset
submit
Message
Message Inquiry
reset
submit