H_TROP2 CHO-K1 Cell Line
Cat. No.
GM-C12880
Size
1 vial
Quote
Product Info
Data display
Materials required
Description
Related products
Product Info

Cat. No:GM-C12880

Product:H_TROP2 CHO-K1 Cell Line

Data display
H_TROP2 CHO-K1 Cell Line (Cat. GM-C12880) was determined by flow cytometry using Anti-H_TROP2 hIgG1 Antibody(Datopotamab) (Cat. GM-26561AB).
The passage stability of the H_TROP2 CHO-K1 Cell Line (Cat. GM-C12880) was determined by flow cytometry using Anti-H_TROP2 hIgG1 Antibody(Datopotamab) (Cat. GM-26561AB).
Materials required

Cell Growth Medium:F12K+10% FBS+1% P.S+4 μg/mL Puromycin

Cell Freezing Medium:90% FBS+10% DMSO


Description

H_TROP2 amino acid sequence :

MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL



Related products
CLDN18
Cynomolgus_CLDN18.2-eGFP CHO-K1 Cell LineH_CLDN18(isoform2)-eGFP 293 Cell LineH_CLDN18.1-eGFP HEK-293 Cell Line
H_CLDN18.2 MC38 Cell LineH_CLDN18.2 MKN45 Cell LineH_CLDN18.2 MKN45 Cell Line(High Expression)
H_CLDN18.2 MKN45 Cell Line(Low Expression)H_CLDN18.2 MKN45 Cell Line(Medium Expression)H_CLDN18.2(isoform2) CHO-K1 Cell Line
H_CLDN18.2-eGFP CT-26 Cell LineMouse_CLDN18.2-eGFP CHO-K1 Cell LineRat_CLDN18.2-eGFP CHO-K1 Cell Line
Rhesus_CLDN18.2-eGFP CHO-K1 Cell Line

Anti-CLDN18.2 hIgG1 Antibody(Zolbetuximab)

HER3(ERBB3)
Cynomolgus_ERBB3(HER3) CHO-K1 Cell Line Cynomolgus_ERBB3(HER3) HEK-293 Cell Line H_ERBB3(HER3) CHO-K1 Cell Line
H_ERBB3(HER3) HEK-293 Cell LineH_ERBB3(HER3) MC38 Cell LineMouse_HER3(ERBB3) CHO-K1 Cell Line
Anti-ERBB3(HER3) hIgG1 Reference Antibody(Patribio)Anti-H_ERBB3(HER3) hIgG1 Antibody(Barecetamab)Anti-H_HER3 hIgG1 Antibody(Patritumab)
Human HER3 Protein; His Tag

C-MET:HGF
H_cMET KO HEK-293 Cell LineH_cMET: cMET Dimerization U2OS Cell LineCynomolgus_cMET CHO-K1 Cell Line
H_cMET CHO-K1 Cell LineH_cMET HEK-293 Cell LineH_cMET HEK-293(cMET KO) Cell Line
Anti-H_HGFR(Met) hIgG4 Antibody(Emibetuzumab)

CD276(B7H3)
Cynomolgus_CD276 CHO-K1 Cell LineH_CD276(B7H3) CHO-K1 Cell Line
Anti-CD276(B7H3) hIgG1 Reference Antibody(Ifibio)

Biotinylated Human CD276(B7H3 2Ig) Protein; His-Avi TagBiotinylated Human CD276(B7H3 4Ig) Protein; His-Avi TagHuman CD276(B7H3 2Ig) Protein; His Tag
Human CD276(B7H3 4Ig) Protein; His Tag

TROP2(TACSTD2)
Cynomolgus_Trop2 CHO-K1 Cell LineCynomolgus_TROP2 HEK-293 Cell LineH_TROP2 CT26 Cell Line
H_TROP2 HEK-293 Cell LineH_TROP2 LLC1 Cell LineH_TROP2 MC38 Cell Line
Anti-H_TROP2 hIgG1 Antibody(Datopotamab)Anti-TROP2 hIgG1 Antibody(Hu2G10-5)Anti-Trop2 hIgG1 Reference Antibody (Sacbio)
Anti-Trop2 hIgG1 Reference Antibody(Datbio)

Anti-Trop2-DXD ADC(Dar4)[Datopotamab deruxtecan,Dato-DXD]Anti-Trop2-SN38 ADC(Dar8)[Sacituzumab govitecan]
Human TROP2 Protein; His Tag

GUCY2C(GC-C)
H_GUCY2C CHO-K1 Cell LineH_GUCY2C HEK-293 Cell Line
Anti-H_GUCY2C hIgG1 Antibody(Indusatumab)

ADC Related Product
Anti-DXD Mouse IgG1 Antibody (23E21C5)Anti-DXD Mouse IgG1 Antibody (4A5A12)Anti-Dxd Mouse IgG2a Antibody (17D6A4)
Anti-Eribulin Mouse IgG2a Antibody (10F8G4)Anti-MMAE Mouse IgG1 Antibody (11C10E3)Anti-MMAE Mouse IgG2a Antibody (17A1K11)
Anti-MMAE Mouse IgG2a Antibody (8F6A3)Mouse anti Human IgG-MMAE(Dar4)
Human IgG1 Isotype-DXD (Dar8)Human IgG1 Isotype-Eribulin (Dar4)Human IgG1 Isotype-MMAE (Dar4)
Recombinant DT3C Protein


For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.
H_TROP2 CHO-K1 Cell Line
Cat. No.
GM-C12880
Size
1 vial
Quote
Product Info
Data display
Materials required
Description
Related products
Product Info

Cat. No:GM-C12880

Product:H_TROP2 CHO-K1 Cell Line

Cat. No:GM-C12880

Product:H_TROP2 CHO-K1 Cell Line

Data display
H_TROP2 CHO-K1 Cell Line (Cat. GM-C12880) was determined by flow cytometry using Anti-H_TROP2 hIgG1 Antibody(Datopotamab) (Cat. GM-26561AB).
The passage stability of the H_TROP2 CHO-K1 Cell Line (Cat. GM-C12880) was determined by flow cytometry using Anti-H_TROP2 hIgG1 Antibody(Datopotamab) (Cat. GM-26561AB).
Materials required

Cell Growth Medium:F12K+10% FBS+1% P.S+4 μg/mL Puromycin

Cell Freezing Medium:90% FBS+10% DMSO


Cell Growth Medium:F12K+10% FBS+1% P.S+4 μg/mL Puromycin

Cell Freezing Medium:90% FBS+10% DMSO


Description

H_TROP2 amino acid sequence :

MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL



H_TROP2 amino acid sequence :

MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL



Related products
CLDN18
Cynomolgus_CLDN18.2-eGFP CHO-K1 Cell LineH_CLDN18(isoform2)-eGFP 293 Cell LineH_CLDN18.1-eGFP HEK-293 Cell Line
H_CLDN18.2 MC38 Cell LineH_CLDN18.2 MKN45 Cell LineH_CLDN18.2 MKN45 Cell Line(High Expression)
H_CLDN18.2 MKN45 Cell Line(Low Expression)H_CLDN18.2 MKN45 Cell Line(Medium Expression)H_CLDN18.2(isoform2) CHO-K1 Cell Line
H_CLDN18.2-eGFP CT-26 Cell LineMouse_CLDN18.2-eGFP CHO-K1 Cell LineRat_CLDN18.2-eGFP CHO-K1 Cell Line
Rhesus_CLDN18.2-eGFP CHO-K1 Cell Line

Anti-CLDN18.2 hIgG1 Antibody(Zolbetuximab)

HER3(ERBB3)
Cynomolgus_ERBB3(HER3) CHO-K1 Cell Line Cynomolgus_ERBB3(HER3) HEK-293 Cell Line H_ERBB3(HER3) CHO-K1 Cell Line
H_ERBB3(HER3) HEK-293 Cell LineH_ERBB3(HER3) MC38 Cell LineMouse_HER3(ERBB3) CHO-K1 Cell Line
Anti-ERBB3(HER3) hIgG1 Reference Antibody(Patribio)Anti-H_ERBB3(HER3) hIgG1 Antibody(Barecetamab)Anti-H_HER3 hIgG1 Antibody(Patritumab)
Human HER3 Protein; His Tag

C-MET:HGF
H_cMET KO HEK-293 Cell LineH_cMET: cMET Dimerization U2OS Cell LineCynomolgus_cMET CHO-K1 Cell Line
H_cMET CHO-K1 Cell LineH_cMET HEK-293 Cell LineH_cMET HEK-293(cMET KO) Cell Line
Anti-H_HGFR(Met) hIgG4 Antibody(Emibetuzumab)

CD276(B7H3)
Cynomolgus_CD276 CHO-K1 Cell LineH_CD276(B7H3) CHO-K1 Cell Line
Anti-CD276(B7H3) hIgG1 Reference Antibody(Ifibio)

Biotinylated Human CD276(B7H3 2Ig) Protein; His-Avi TagBiotinylated Human CD276(B7H3 4Ig) Protein; His-Avi TagHuman CD276(B7H3 2Ig) Protein; His Tag
Human CD276(B7H3 4Ig) Protein; His Tag

TROP2(TACSTD2)
Cynomolgus_Trop2 CHO-K1 Cell LineCynomolgus_TROP2 HEK-293 Cell LineH_TROP2 CT26 Cell Line
H_TROP2 HEK-293 Cell LineH_TROP2 LLC1 Cell LineH_TROP2 MC38 Cell Line
Anti-H_TROP2 hIgG1 Antibody(Datopotamab)Anti-TROP2 hIgG1 Antibody(Hu2G10-5)Anti-Trop2 hIgG1 Reference Antibody (Sacbio)
Anti-Trop2 hIgG1 Reference Antibody(Datbio)

Anti-Trop2-DXD ADC(Dar4)[Datopotamab deruxtecan,Dato-DXD]Anti-Trop2-SN38 ADC(Dar8)[Sacituzumab govitecan]
Human TROP2 Protein; His Tag

GUCY2C(GC-C)
H_GUCY2C CHO-K1 Cell LineH_GUCY2C HEK-293 Cell Line
Anti-H_GUCY2C hIgG1 Antibody(Indusatumab)

ADC Related Product
Anti-DXD Mouse IgG1 Antibody (23E21C5)Anti-DXD Mouse IgG1 Antibody (4A5A12)Anti-Dxd Mouse IgG2a Antibody (17D6A4)
Anti-Eribulin Mouse IgG2a Antibody (10F8G4)Anti-MMAE Mouse IgG1 Antibody (11C10E3)Anti-MMAE Mouse IgG2a Antibody (17A1K11)
Anti-MMAE Mouse IgG2a Antibody (8F6A3)Mouse anti Human IgG-MMAE(Dar4)
Human IgG1 Isotype-DXD (Dar8)Human IgG1 Isotype-Eribulin (Dar4)Human IgG1 Isotype-MMAE (Dar4)
Recombinant DT3C Protein


Message consultation
reset
submit
Message
Message consultation
reset
submit