Where Discovery Begins
H_TROP2 CT26 Cell Line
Cat. No.
GM-C33032
Size
2 vial
Quote
Specifications
Data Display
Materials
Cell Culture
Sequence
Related products
Specifications
Product H_TROP2 CT26 Cell Line
Description H_TROP2 CT26 Cell Line is a clonal stable CT26 cell line that constitutively expresses the human TROP2 gene, constructed using lentiviral technology.
Product Format 1 vial of frozen cells
Quantity 5E6 Cells per vial,1 mL
Storage Conditions Liquid nitrogen immediately upon receipt
Target Human_TROP2
Gene ID/Uniprot ID P09758(AA Met 1 - Ile 297)
Host Cell CT26
Recovery Medium RPMI 1640+10% FBS+1% P.S
Growth medium RPMI 1640+10% FBS+1% P.S+4 μg/mL Puromycin
Note None
Freezing Medium 90% FBS+10% DMSO
Growth properties Adherent
Growth Conditions 37°C, 5% CO₂
Safety considerations Biosafety Level 2
Mycoplasma Testing The cell line has been screened to confirm the absence of Mycoplasma species.
Data Display
33032
H_TROP2 CT26 Cell Line(Cat. GM-C33032) was determined by flow cytometry using Anti-Trop2 hIgG1 Reference Antibody(Datbio) (Cat. GM-87498MAB).
Tumor growth curves of H_TROP2 CT26 in BALB/C mice. H_TROP2 CT26 cells (1×10^6 per mouse) were subcutaneously inoculated into BALB/C mice (female, 8 weeks old, n = 8 or 6). Tumor volume was measured twice per week and is presented as mean ± SEM.
Body weight changes after implantation of H_TROP2 CT26 in BALB/C mice. Under the same conditions, body weight was measured twice per week and is presented as mean ± SEM.
Materials
Reagent Ordering Information
RPMI 1640 VivaCell/C3010-0500
Fetal Bovine Serum ExCell/FSP500
Pen/Strep Thermo/15140-122
Puromycin Genomeditech/GM-040401
Anti-Trop2 hIgG1 Reference Antibody Genomeditech/GM-87498MAB
Cell Culture

Cell Recovery

Recovery Medium: RPMI 1640+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: RPMI 1640+10% FBS+1% P.S+4 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Remove and discard culture medium.

b)         Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

c)          Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 30 to 60 seconds at 37°C).

d)         Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

e)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

f)          After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

g)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:3 - 1:5 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          After the stabilization of the cell condition, there will be fewer dead cells post-passage, the cell growth rate will tend to stabilize, cell morphology will become uniform, and the cells will appear robust.

Sequence

TACSTD2(TROP2) P09758(ΔICD)
MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVI*

Related products
CLDN18
Cynomolgus_CLDN18.2-eGFP CHO-K1 Cell Line H_CLDN18(isoform2)-eGFP 293 Cell Line H_CLDN18.1-eGFP HEK-293 Cell Line
H_CLDN18.2 MC38 Cell Line H_CLDN18.2 MKN45 Cell Line(High Expression) H_CLDN18.2 MKN45 Cell Line(Low Expression)
H_CLDN18.2 MKN45 Cell Line(Medium Expression) H_CLDN18.2(isoform2) CHO-K1 Cell Line H_CLDN18.2(isoform2) MKN45 Cell Line
H_CLDN18.2-eGFP CT-26 Cell Line Mouse_CLDN18.2-eGFP CHO-K1 Cell Line Rat_CLDN18.2-eGFP CHO-K1 Cell Line
Rhesus_CLDN18.2-eGFP CHO-K1 Cell Line    
Anti-CLDN18.2  hIgG1 Reference Antibody  Anti-CLDN18.2 hIgG1 Antibody(LM-102) Anti-CLDN18.2 hIgG1 Antibody
HER3(ERBB3)
Cynomolgus_ERBB3(HER3) CHO-K1 Cell Line Cynomolgus_ERBB3(HER3) HEK-293 Cell Line H_ERBB3(HER3) CHO-K1 Cell Line
H_ERBB3(HER3) HEK-293 Cell Line H_ERBB3(HER3) MC38 Cell Line Mouse_HER3(ERBB3) CHO-K1 Cell Line
Anti-ERBB3(HER3) hIgG1 Reference Antibody Anti-H_ERBB3(HER3) hIgG1 Antibody  
Biotinylated Human HER3 Protein; His-Avi Tag Human HER3 Protein; His Tag Mouse HER3 Protein; His Tag
C-MET:HGF
H_cMET KO HEK-293 Cell Line H_cMET: cMET Dimerization U2OS Cell Line Cynomolgus_cMET CHO-K1 Cell Line
H_cMET CHO-K1 Cell Line H_cMET HEK-293 Cell Line H_cMET HEK-293(cMET KO) Cell Line
Anti-H_HGFR(Met) hIgG4 Antibody Human HGFR(Met) Protein; His Tag  
CD276(B7H3)
Cynomolgus_CD276 CHO-K1 Cell Line H_CD276(B7H3) CHO-K1 Cell Line Human CD276(B7H3 4Ig) Protein; His Tag
Anti-CD276(B7H3) hIgG1 Reference Antibody Anti-CD276(B7H3)-DXD (Dar4) Human CD276(B7H3 2Ig) Protein; His Tag
Biotinylated Human CD276(B7H3 2Ig) Protein; His-Avi Tag Biotinylated Human CD276(B7H3 4Ig) Protein; His-Avi Tag  
TROP2(TACSTD2)
Cynomolgus_Trop2 CHO-K1 Cell Line Cynomolgus_TROP2 HEK-293 Cell Line H_TROP2 CHO-K1 Cell Line
H_TROP2 HEK-293 Cell Line H_TROP2 LLC1 Cell Line H_TROP2 MC38 Cell Line
Anti-Trop2 hIgG1 Reference Antibody Anti-Trop2-DXD ADC(Dar4) Anti-Trop2-SN38 ADC(Dar8)
Biotinylated Cynomolgus TROP2 Protein; His-Avi Tag Biotinylated Human TROP2 Protein; His-Avi Tag Human TROP2 Protein; His Tag
GUCY2C(GC-C)
Cynomolgus_GUCY2C HEK-293 Cell Line H_GUCY2C CHO-K1 Cell Line H_GUCY2C HEK-293 Cell Line
Anti-H_GUCY2C hIgG1 Antibody    
CD44-CD44v6
H_CD44v6 HEK-293 Cell Line Anti-CD44v6 hIgG1 Antibody  
ADC Related Product
Anti-DXD Mouse IgG1 Antibody (23E21C5) Anti-DXD Mouse IgG1 Antibody (4A5A12) Anti-Dxd Mouse IgG2a Antibody (17D6A4)
Anti-Eribulin Mouse IgG2a Antibody (10F8G4) Anti-MMAE Mouse IgG1 Antibody (11C10E3) Anti-MMAE Mouse IgG2a Antibody (17A1K11)
Anti-MMAE Mouse IgG2a Antibody (8F6A3) Mouse anti Human IgG1-MMAE(Dar4) Human IgG1 Isotype-DXD (Dar8)
Human IgG1 Isotype-Eribulin (Dar4) Human IgG1 Isotype-MMAE (Dar4) Recombinant DT3C Protein
For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.
H_TROP2 CT26 Cell Line
Cat. No.
GM-C33032
Size
2 vial
Quote
Specifications
Data Display
Materials
Cell Culture
Sequence
Related products
Specifications
Product H_TROP2 CT26 Cell Line
Description H_TROP2 CT26 Cell Line is a clonal stable CT26 cell line that constitutively expresses the human TROP2 gene, constructed using lentiviral technology.
Product Format 1 vial of frozen cells
Quantity 5E6 Cells per vial,1 mL
Storage Conditions Liquid nitrogen immediately upon receipt
Target Human_TROP2
Gene ID/Uniprot ID P09758(AA Met 1 - Ile 297)
Host Cell CT26
Recovery Medium RPMI 1640+10% FBS+1% P.S
Growth medium RPMI 1640+10% FBS+1% P.S+4 μg/mL Puromycin
Note None
Freezing Medium 90% FBS+10% DMSO
Growth properties Adherent
Growth Conditions 37°C, 5% CO₂
Safety considerations Biosafety Level 2
Mycoplasma Testing The cell line has been screened to confirm the absence of Mycoplasma species.
Product H_TROP2 CT26 Cell Line
Description H_TROP2 CT26 Cell Line is a clonal stable CT26 cell line that constitutively expresses the human TROP2 gene, constructed using lentiviral technology.
Product Format 1 vial of frozen cells
Quantity 5E6 Cells per vial,1 mL
Storage Conditions Liquid nitrogen immediately upon receipt
Target Human_TROP2
Gene ID/Uniprot ID P09758(AA Met 1 - Ile 297)
Host Cell CT26
Recovery Medium RPMI 1640+10% FBS+1% P.S
Growth medium RPMI 1640+10% FBS+1% P.S+4 μg/mL Puromycin
Note None
Freezing Medium 90% FBS+10% DMSO
Growth properties Adherent
Growth Conditions 37°C, 5% CO₂
Safety considerations Biosafety Level 2
Mycoplasma Testing The cell line has been screened to confirm the absence of Mycoplasma species.
Data Display
33032
H_TROP2 CT26 Cell Line(Cat. GM-C33032) was determined by flow cytometry using Anti-Trop2 hIgG1 Reference Antibody(Datbio) (Cat. GM-87498MAB).
Tumor growth curves of H_TROP2 CT26 in BALB/C mice. H_TROP2 CT26 cells (1×10^6 per mouse) were subcutaneously inoculated into BALB/C mice (female, 8 weeks old, n = 8 or 6). Tumor volume was measured twice per week and is presented as mean ± SEM.
Body weight changes after implantation of H_TROP2 CT26 in BALB/C mice. Under the same conditions, body weight was measured twice per week and is presented as mean ± SEM.
Materials
Reagent Ordering Information
RPMI 1640 VivaCell/C3010-0500
Fetal Bovine Serum ExCell/FSP500
Pen/Strep Thermo/15140-122
Puromycin Genomeditech/GM-040401
Anti-Trop2 hIgG1 Reference Antibody Genomeditech/GM-87498MAB
Reagent Ordering Information
RPMI 1640 VivaCell/C3010-0500
Fetal Bovine Serum ExCell/FSP500
Pen/Strep Thermo/15140-122
Puromycin Genomeditech/GM-040401
Anti-Trop2 hIgG1 Reference Antibody Genomeditech/GM-87498MAB
Cell Culture

Cell Recovery

Recovery Medium: RPMI 1640+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: RPMI 1640+10% FBS+1% P.S+4 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Remove and discard culture medium.

b)         Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

c)          Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 30 to 60 seconds at 37°C).

d)         Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

e)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

f)          After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

g)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:3 - 1:5 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          After the stabilization of the cell condition, there will be fewer dead cells post-passage, the cell growth rate will tend to stabilize, cell morphology will become uniform, and the cells will appear robust.

Cell Recovery

Recovery Medium: RPMI 1640+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: RPMI 1640+10% FBS+1% P.S+4 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Remove and discard culture medium.

b)         Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

c)          Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 30 to 60 seconds at 37°C).

d)         Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

e)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

f)          After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

g)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:3 - 1:5 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          After the stabilization of the cell condition, there will be fewer dead cells post-passage, the cell growth rate will tend to stabilize, cell morphology will become uniform, and the cells will appear robust.

Sequence

TACSTD2(TROP2) P09758(ΔICD)
MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVI*

TACSTD2(TROP2) P09758(ΔICD)
MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVI*

Related products
CLDN18
Cynomolgus_CLDN18.2-eGFP CHO-K1 Cell Line H_CLDN18(isoform2)-eGFP 293 Cell Line H_CLDN18.1-eGFP HEK-293 Cell Line
H_CLDN18.2 MC38 Cell Line H_CLDN18.2 MKN45 Cell Line(High Expression) H_CLDN18.2 MKN45 Cell Line(Low Expression)
H_CLDN18.2 MKN45 Cell Line(Medium Expression) H_CLDN18.2(isoform2) CHO-K1 Cell Line H_CLDN18.2(isoform2) MKN45 Cell Line
H_CLDN18.2-eGFP CT-26 Cell Line Mouse_CLDN18.2-eGFP CHO-K1 Cell Line Rat_CLDN18.2-eGFP CHO-K1 Cell Line
Rhesus_CLDN18.2-eGFP CHO-K1 Cell Line    
Anti-CLDN18.2  hIgG1 Reference Antibody  Anti-CLDN18.2 hIgG1 Antibody(LM-102) Anti-CLDN18.2 hIgG1 Antibody
HER3(ERBB3)
Cynomolgus_ERBB3(HER3) CHO-K1 Cell Line Cynomolgus_ERBB3(HER3) HEK-293 Cell Line H_ERBB3(HER3) CHO-K1 Cell Line
H_ERBB3(HER3) HEK-293 Cell Line H_ERBB3(HER3) MC38 Cell Line Mouse_HER3(ERBB3) CHO-K1 Cell Line
Anti-ERBB3(HER3) hIgG1 Reference Antibody Anti-H_ERBB3(HER3) hIgG1 Antibody  
Biotinylated Human HER3 Protein; His-Avi Tag Human HER3 Protein; His Tag Mouse HER3 Protein; His Tag
C-MET:HGF
H_cMET KO HEK-293 Cell Line H_cMET: cMET Dimerization U2OS Cell Line Cynomolgus_cMET CHO-K1 Cell Line
H_cMET CHO-K1 Cell Line H_cMET HEK-293 Cell Line H_cMET HEK-293(cMET KO) Cell Line
Anti-H_HGFR(Met) hIgG4 Antibody Human HGFR(Met) Protein; His Tag  
CD276(B7H3)
Cynomolgus_CD276 CHO-K1 Cell Line H_CD276(B7H3) CHO-K1 Cell Line Human CD276(B7H3 4Ig) Protein; His Tag
Anti-CD276(B7H3) hIgG1 Reference Antibody Anti-CD276(B7H3)-DXD (Dar4) Human CD276(B7H3 2Ig) Protein; His Tag
Biotinylated Human CD276(B7H3 2Ig) Protein; His-Avi Tag Biotinylated Human CD276(B7H3 4Ig) Protein; His-Avi Tag  
TROP2(TACSTD2)
Cynomolgus_Trop2 CHO-K1 Cell Line Cynomolgus_TROP2 HEK-293 Cell Line H_TROP2 CHO-K1 Cell Line
H_TROP2 HEK-293 Cell Line H_TROP2 LLC1 Cell Line H_TROP2 MC38 Cell Line
Anti-Trop2 hIgG1 Reference Antibody Anti-Trop2-DXD ADC(Dar4) Anti-Trop2-SN38 ADC(Dar8)
Biotinylated Cynomolgus TROP2 Protein; His-Avi Tag Biotinylated Human TROP2 Protein; His-Avi Tag Human TROP2 Protein; His Tag
GUCY2C(GC-C)
Cynomolgus_GUCY2C HEK-293 Cell Line H_GUCY2C CHO-K1 Cell Line H_GUCY2C HEK-293 Cell Line
Anti-H_GUCY2C hIgG1 Antibody    
CD44-CD44v6
H_CD44v6 HEK-293 Cell Line Anti-CD44v6 hIgG1 Antibody  
ADC Related Product
Anti-DXD Mouse IgG1 Antibody (23E21C5) Anti-DXD Mouse IgG1 Antibody (4A5A12) Anti-Dxd Mouse IgG2a Antibody (17D6A4)
Anti-Eribulin Mouse IgG2a Antibody (10F8G4) Anti-MMAE Mouse IgG1 Antibody (11C10E3) Anti-MMAE Mouse IgG2a Antibody (17A1K11)
Anti-MMAE Mouse IgG2a Antibody (8F6A3) Mouse anti Human IgG1-MMAE(Dar4) Human IgG1 Isotype-DXD (Dar8)
Human IgG1 Isotype-Eribulin (Dar4) Human IgG1 Isotype-MMAE (Dar4) Recombinant DT3C Protein
Contact
Us
Message Inquiry
reset
submit
Message
Message Inquiry
reset
submit