Current position:Product Center > Cell lines > Immune checkpoints > OX40 > H_OX40L CHO-K1 Cell Line
H_OX40L CHO-K1 Cell Line
Product Info

Cat. No:GM-C35016

Product:H_OX40L CHO-K1 Cell Line


产品配图.jpg

Materials required

Cell Growth Medium:F12K+10% FBS+1% P.S+100 μg/mL Hygromycin

Cell Freezing Medium:90% FBS+10% DMSO

Description



H_OX40L Amino acid sequence  (P23510-1):

MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Data
Message Consultation
If you have more questions, please fill in the relevant information,we'll respond as soon as possible to assist you!
Reset
Submit
You can also contact us on the Scientist and Science Exchange marketplaces.
Current Position:Product Center > Cell lines > Immune checkpoints > OX40 > H_OX40L CHO-K1 Cell Line
classify
H_OX40L CHO-K1 Cell Line
Product Info

Cat. No:GM-C35016

Product:H_OX40L CHO-K1 Cell Line


产品配图.jpg

Materials required

Cell Growth Medium:F12K+10% FBS+1% P.S+100 μg/mL Hygromycin

Cell Freezing Medium:90% FBS+10% DMSO

Description



H_OX40L Amino acid sequence  (P23510-1):

MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Data
Message Consultation
If you have more questions, please fill in the relevant information,we'll respond as soon as possible to assist you!
Reset
Submit
You can also contact us on the Scientist and Science Exchange marketplaces.
Message consultation
reset
submit
Service
Message
Message consultation
reset
submit