Flag-Mouse_Mrgprb2 CHO-K1 Cell Line
Cat. No.
GM-C41135
Size
Quote
Specifications
Data display
Materials
Cell Culture
Related products
Sequence
Specifications
Cat. NoGM-C41135
ProductFlag-Mouse_Mrgprb2 CHO-K1 Cell Line
DescriptionFlag-Mouse_Mrgprb2 CHO-K1 Cell Line is a clonal stable CHO-K1 cell line that constitutively expresses the Flag-Mouse Mrgprb2 gene, constructed using lentiviral technology.
Product Format1 vial of frozen cells
Quantity5E6 Cells per vial,1 mL
Storage ConditionsLiquid nitrogen immediately upon receipt
TargetFlag-Mouse_Mrgprb2
Gene ID/Uniprot IDQ3KNA1
Host CellCHO-K1
Recovery MediumF12K+10% FBS+1% P.S
Growth mediumF12K+10% FBS+1% P.S+4 μg/mL Puromycin
NoteNone
Freezing Medium90% FBS+10% DMSO
Growth propertiesAdherent
Growth Conditions37°C, 5% CO₂
Safety considerationsBiosafety Level 2
Mycoplasma TestingThe cell line has been screened to confirm the absence of Mycoplasma species.
Data display
Flag-Mouse_Mrgprb2 CHO-K1 Cell Line (Cat. GM-C41135) was determined by flow cytometry using Anti-Flag mIgG1 Antibody (Cat. GM-30726AB).
Materials
ReagentOrdering Information
F12KBOSTER/PYG0036
Fetal Bovine SerumExCell/FSP500
Pen/StrepThermo/15140-122
PuromycinGenomeditech/GM-040401
Anti-Flag mIgG1 AntibodyGenomeditech/GM-30726AB
Cell Culture

Cell Recovery

Recovery Medium: F12K+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: F12K+10% FBS+1% P.S+4 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Remove and discard culture medium.

b)         Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

c)          Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 2 to 3 minutes at 37°C).

d)         Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

e)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

f)          After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

g)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:4 - 1:5 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          After the stabilization of the cell condition, there will be fewer dead cells post-passage, the cell growth rate will tend to stabilize, cell morphology will become uniform, and the cells will appear robust.


Related products
OX40
H_OX40 Reporter Cell LineH_OX40 Reporter DDX35TM Cell LineCynomolgus_OX40L CHO-K1 Cell Line
H_OX40 CHO-K1 Cell LineH_OX40L CHO-K1 Cell LineH_OX40L HEK-293 Cell Line
Anti-H_OX40 hIgG2 Antibody(Ivuxolimab)Anti-OX40L hIgG1 Reference Antibody(Oxebio)Anti-OX40L hIgG4 Antibody(Amlitelimab)
Anti-OX40L hIgG4 Reference Antibody(Amlbio)

Biotinylated Human OX40L Protein; His-Avi TagCynomolgus OX40 Protein; His TagCynomolgus OX40L Protein; His Tag
Cynomolgus OX40L Protein; mFc TagHuman OX40 Protein; His TagHuman OX40L Protein; His Tag
Human OX40L Protein; mFc Tag

IL-4/IL-13
IL-4 Reporter Cell LineIL-4/IL-13 Reporter 293 Cell LineIL-4/IL-13 Reporter 293 DDX35TM Cell Line
Cynomolgus_IL4R CHO-K1 Cell LineH_IL4R CHO-K1 Cell LineMouse_IL4R CHO-K1 Cell Line
Anti-IL-4R hIgG1 Antibody(12B5)Anti-IL4R hIgG4 Antibody(Dupilumab)Anti-IL4R hIgG4 Reference Antibody (Dupbio)
Biotinylated Human IL-4R alpha Protein; Avi-His TagCynomolgus IL-4R alpha Protein; His TagHuman IL-4 Protein; His Tag
Human IL-4R alpha Protein; hFc TagHuman IL-4R alpha Protein; His TagHuman IL-4R alpha Protein; mFc Tag
Mouse IL-13 Protein; His TagMouse IL-4R alpha Protein; His TagRat IL-4R alpha Protein; His Tag
IL-31
Cynomolgus_IL-31RA OSMR Reporter Baf3 Cell LineH_IL-31 Reporter Cell LineCynomolgus_IL31RA CHO-K1 Cell Line
H_IL31RA CHO-K1 Cell LineH_IL31RA HEK-293 Cell LineH_IL-31RA OSMR Baf3 Cell Line
Anti-IL31 hIgG1 Antibody(mAb33)Anti-IL31RA hIgG1 Antibody(NA633)Anti-IL31RA hIgG2 Antibody(Nemolizumab)
Anti-OSMR hIgG4 Antibody(Vixarelimab)

Cynomolgus IL-31 Protein; His TagHuman IL-31 Protein; His TagHuman IL-31RA Protein; hFc Tag
c-Kit:SCF
H_c-Kit(CD117) GNNK(-) 293 Blockade Reporter Cell LineCynomolgus_c-Kit(CD117) GNNK(-) CHO-K1 Cell LineH_c-Kit(CD117) GNNK(-) CHO-K1 Cell Line
H_c-Kit(CD117) GNNK(-) HEK-293 Cell LineH_c-Kit(CD117) GNNK(+) CHO-K1 Cell Line
Anti-c-Kit(CD117) hIgG1 Antibody(barzolvolimab)Anti-c-Kit(CD117) hIgG1 Antibody(briquilimab)Anti-c-Kit(CD117) hIgG1 Reference Antibody(barbio)
Biotinylated Human c-Kit(CD117) Protein; His-Avi TagBiotinylated Human SCF Protein; His-Avi TagCynomolgus c-Kit(CD117) Protein; His Tag
Human c-Kit(CD117) D4-D5 Protein; His TagHuman c-Kit(CD117) Protein; hFc TagHuman c-Kit(CD117) Protein; His Tag
Human SCF Protein; His TagHuman SCF Protein; mFc Tag
MRGPRX2
H_MRGPRX2 Reporter Cell LineTango-H_MRGPRX2 CHO-K1 Cell LineCynomolgus_MRGPRX2 CHO-K1 Cell Line
Cynomolgus_MRGPRX2 HEK-293 Cell LineFlag-Rat_Mrgprb3 HEK-293 Cell LineH_MRGPRX2 CHO-K1 Cell Line
H_MRGPRX2 HEK-293 Cell LineH_MRGPRX2 RBL-2H3 Cell Line
IGHE(FcεRIα)
Cynomolgus IgE D2-D4 Protein; His TagHuman FCER1A Protein; His TagHuman FCER2(CD23) Protein; His Tag
Human IgE D2-D4 Protein; His Tag

Sequence

Flag-Mrgprb2 Q3KNA1
DYKDDDDKGSGMSGDFLIKNLSTSAWKTNITVLNGSYYIDTSVCVTRNQAMILLSIIISLVGMGLNAIVLWFLGIRMHTNAFTVYILNLAMADFLYLCSQFVICLLIAFYIFYSIDINIPLVLYVVPIFAYLSGLSILSTISIERCLSVIWPIWYRCKRPRHTSAITCFVLWVMSLLLGLLEGKACGLLFNSFDSYWCETFDVITNIWSVVFFGVLCGSSLTLLVRIFCGSQRIPMTRLYVTITLTVLVFLIFGLPFGIYWILYQWISNFYYVEICNFYLEILFLSCVNSCMNPIIYFLVGSIRHRRFRRKTLKLLLQRAMQDTPEEEQSGNKSSSEHPEELETVQSCS*

Flag-Mouse_Mrgprb2 CHO-K1 Cell Line
Cat. No.
GM-C41135
Size
Quote
Specifications
Data display
Materials
Cell Culture
Related products
Sequence
Specifications
Cat. NoGM-C41135
ProductFlag-Mouse_Mrgprb2 CHO-K1 Cell Line
DescriptionFlag-Mouse_Mrgprb2 CHO-K1 Cell Line is a clonal stable CHO-K1 cell line that constitutively expresses the Flag-Mouse Mrgprb2 gene, constructed using lentiviral technology.
Product Format1 vial of frozen cells
Quantity5E6 Cells per vial,1 mL
Storage ConditionsLiquid nitrogen immediately upon receipt
TargetFlag-Mouse_Mrgprb2
Gene ID/Uniprot IDQ3KNA1
Host CellCHO-K1
Recovery MediumF12K+10% FBS+1% P.S
Growth mediumF12K+10% FBS+1% P.S+4 μg/mL Puromycin
NoteNone
Freezing Medium90% FBS+10% DMSO
Growth propertiesAdherent
Growth Conditions37°C, 5% CO₂
Safety considerationsBiosafety Level 2
Mycoplasma TestingThe cell line has been screened to confirm the absence of Mycoplasma species.
Cat. NoGM-C41135
ProductFlag-Mouse_Mrgprb2 CHO-K1 Cell Line
DescriptionFlag-Mouse_Mrgprb2 CHO-K1 Cell Line is a clonal stable CHO-K1 cell line that constitutively expresses the Flag-Mouse Mrgprb2 gene, constructed using lentiviral technology.
Product Format1 vial of frozen cells
Quantity5E6 Cells per vial,1 mL
Storage ConditionsLiquid nitrogen immediately upon receipt
TargetFlag-Mouse_Mrgprb2
Gene ID/Uniprot IDQ3KNA1
Host CellCHO-K1
Recovery MediumF12K+10% FBS+1% P.S
Growth mediumF12K+10% FBS+1% P.S+4 μg/mL Puromycin
NoteNone
Freezing Medium90% FBS+10% DMSO
Growth propertiesAdherent
Growth Conditions37°C, 5% CO₂
Safety considerationsBiosafety Level 2
Mycoplasma TestingThe cell line has been screened to confirm the absence of Mycoplasma species.
Data display
Flag-Mouse_Mrgprb2 CHO-K1 Cell Line (Cat. GM-C41135) was determined by flow cytometry using Anti-Flag mIgG1 Antibody (Cat. GM-30726AB).
Materials
ReagentOrdering Information
F12KBOSTER/PYG0036
Fetal Bovine SerumExCell/FSP500
Pen/StrepThermo/15140-122
PuromycinGenomeditech/GM-040401
Anti-Flag mIgG1 AntibodyGenomeditech/GM-30726AB
ReagentOrdering Information
F12KBOSTER/PYG0036
Fetal Bovine SerumExCell/FSP500
Pen/StrepThermo/15140-122
PuromycinGenomeditech/GM-040401
Anti-Flag mIgG1 AntibodyGenomeditech/GM-30726AB
Cell Culture

Cell Recovery

Recovery Medium: F12K+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: F12K+10% FBS+1% P.S+4 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Remove and discard culture medium.

b)         Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

c)          Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 2 to 3 minutes at 37°C).

d)         Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

e)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

f)          After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

g)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:4 - 1:5 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          After the stabilization of the cell condition, there will be fewer dead cells post-passage, the cell growth rate will tend to stabilize, cell morphology will become uniform, and the cells will appear robust.


Cell Recovery

Recovery Medium: F12K+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: F12K+10% FBS+1% P.S+4 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Remove and discard culture medium.

b)         Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

c)          Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 2 to 3 minutes at 37°C).

d)         Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

e)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

f)          After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

g)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:4 - 1:5 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          After the stabilization of the cell condition, there will be fewer dead cells post-passage, the cell growth rate will tend to stabilize, cell morphology will become uniform, and the cells will appear robust.


Related products
OX40
H_OX40 Reporter Cell LineH_OX40 Reporter DDX35TM Cell LineCynomolgus_OX40L CHO-K1 Cell Line
H_OX40 CHO-K1 Cell LineH_OX40L CHO-K1 Cell LineH_OX40L HEK-293 Cell Line
Anti-H_OX40 hIgG2 Antibody(Ivuxolimab)Anti-OX40L hIgG1 Reference Antibody(Oxebio)Anti-OX40L hIgG4 Antibody(Amlitelimab)
Anti-OX40L hIgG4 Reference Antibody(Amlbio)

Biotinylated Human OX40L Protein; His-Avi TagCynomolgus OX40 Protein; His TagCynomolgus OX40L Protein; His Tag
Cynomolgus OX40L Protein; mFc TagHuman OX40 Protein; His TagHuman OX40L Protein; His Tag
Human OX40L Protein; mFc Tag

IL-4/IL-13
IL-4 Reporter Cell LineIL-4/IL-13 Reporter 293 Cell LineIL-4/IL-13 Reporter 293 DDX35TM Cell Line
Cynomolgus_IL4R CHO-K1 Cell LineH_IL4R CHO-K1 Cell LineMouse_IL4R CHO-K1 Cell Line
Anti-IL-4R hIgG1 Antibody(12B5)Anti-IL4R hIgG4 Antibody(Dupilumab)Anti-IL4R hIgG4 Reference Antibody (Dupbio)
Biotinylated Human IL-4R alpha Protein; Avi-His TagCynomolgus IL-4R alpha Protein; His TagHuman IL-4 Protein; His Tag
Human IL-4R alpha Protein; hFc TagHuman IL-4R alpha Protein; His TagHuman IL-4R alpha Protein; mFc Tag
Mouse IL-13 Protein; His TagMouse IL-4R alpha Protein; His TagRat IL-4R alpha Protein; His Tag
IL-31
Cynomolgus_IL-31RA OSMR Reporter Baf3 Cell LineH_IL-31 Reporter Cell LineCynomolgus_IL31RA CHO-K1 Cell Line
H_IL31RA CHO-K1 Cell LineH_IL31RA HEK-293 Cell LineH_IL-31RA OSMR Baf3 Cell Line
Anti-IL31 hIgG1 Antibody(mAb33)Anti-IL31RA hIgG1 Antibody(NA633)Anti-IL31RA hIgG2 Antibody(Nemolizumab)
Anti-OSMR hIgG4 Antibody(Vixarelimab)

Cynomolgus IL-31 Protein; His TagHuman IL-31 Protein; His TagHuman IL-31RA Protein; hFc Tag
c-Kit:SCF
H_c-Kit(CD117) GNNK(-) 293 Blockade Reporter Cell LineCynomolgus_c-Kit(CD117) GNNK(-) CHO-K1 Cell LineH_c-Kit(CD117) GNNK(-) CHO-K1 Cell Line
H_c-Kit(CD117) GNNK(-) HEK-293 Cell LineH_c-Kit(CD117) GNNK(+) CHO-K1 Cell Line
Anti-c-Kit(CD117) hIgG1 Antibody(barzolvolimab)Anti-c-Kit(CD117) hIgG1 Antibody(briquilimab)Anti-c-Kit(CD117) hIgG1 Reference Antibody(barbio)
Biotinylated Human c-Kit(CD117) Protein; His-Avi TagBiotinylated Human SCF Protein; His-Avi TagCynomolgus c-Kit(CD117) Protein; His Tag
Human c-Kit(CD117) D4-D5 Protein; His TagHuman c-Kit(CD117) Protein; hFc TagHuman c-Kit(CD117) Protein; His Tag
Human SCF Protein; His TagHuman SCF Protein; mFc Tag
MRGPRX2
H_MRGPRX2 Reporter Cell LineTango-H_MRGPRX2 CHO-K1 Cell LineCynomolgus_MRGPRX2 CHO-K1 Cell Line
Cynomolgus_MRGPRX2 HEK-293 Cell LineFlag-Rat_Mrgprb3 HEK-293 Cell LineH_MRGPRX2 CHO-K1 Cell Line
H_MRGPRX2 HEK-293 Cell LineH_MRGPRX2 RBL-2H3 Cell Line
IGHE(FcεRIα)
Cynomolgus IgE D2-D4 Protein; His TagHuman FCER1A Protein; His TagHuman FCER2(CD23) Protein; His Tag
Human IgE D2-D4 Protein; His Tag

Sequence

Flag-Mrgprb2 Q3KNA1
DYKDDDDKGSGMSGDFLIKNLSTSAWKTNITVLNGSYYIDTSVCVTRNQAMILLSIIISLVGMGLNAIVLWFLGIRMHTNAFTVYILNLAMADFLYLCSQFVICLLIAFYIFYSIDINIPLVLYVVPIFAYLSGLSILSTISIERCLSVIWPIWYRCKRPRHTSAITCFVLWVMSLLLGLLEGKACGLLFNSFDSYWCETFDVITNIWSVVFFGVLCGSSLTLLVRIFCGSQRIPMTRLYVTITLTVLVFLIFGLPFGIYWILYQWISNFYYVEICNFYLEILFLSCVNSCMNPIIYFLVGSIRHRRFRRKTLKLLLQRAMQDTPEEEQSGNKSSSEHPEELETVQSCS*

Flag-Mrgprb2 Q3KNA1
DYKDDDDKGSGMSGDFLIKNLSTSAWKTNITVLNGSYYIDTSVCVTRNQAMILLSIIISLVGMGLNAIVLWFLGIRMHTNAFTVYILNLAMADFLYLCSQFVICLLIAFYIFYSIDINIPLVLYVVPIFAYLSGLSILSTISIERCLSVIWPIWYRCKRPRHTSAITCFVLWVMSLLLGLLEGKACGLLFNSFDSYWCETFDVITNIWSVVFFGVLCGSSLTLLVRIFCGSQRIPMTRLYVTITLTVLVFLIFGLPFGIYWILYQWISNFYYVEICNFYLEILFLSCVNSCMNPIIYFLVGSIRHRRFRRKTLKLLLQRAMQDTPEEEQSGNKSSSEHPEELETVQSCS*

Message consultation
reset
submit
Message
Message consultation
reset
submit