H_OX40L HEK-293 Cell Line
Cat. No.
GM-C35017
Size
Quote
Specifications
Data display
Materials required
Description
Related products
Sequence
Specifications
Cat. NoGM-C35017
ProductH_OX40L HEK-293 Cell Line
DescriptionH_OX40L HEK-293 Cell Line is a clonal stable HEK-293 cell line constitutively expressing human OX40L.
Product Format1 vial of frozen cells
Quantity5E6 Cells per vial,1 mL
Storage ConditionsLiquid nitrogen immediately upon receipt
TargetHuman_OX40L
Gene ID/Uniprot IDP23510-1
Host CellHEK-293
Recovery MediumDMEM+10% FBS+1% P.S
Growth mediumDMEM+10% FBS+1% P.S+125 μg/mL Hygromycin
NoteNone
Freezing Medium90% FBS+10% DMSO
Growth propertiesAdherent
Growth Conditions37°C, 5% CO₂
Safety considerationsBiosafety Level 2
Mycoplasma TestingThe cell line has been screened to confirm the absence of Mycoplasma species.
Data display
H_OX40L HEK-293 Cell Line (Cat. GM-C35017) was determined by flow cytometry using Anti-OX40L hIgG4 Antibody(Amlitelimab) (Cat. GM-82533AB).
Materials required
ReagentOrdering Information
DMEMGibco/C11995500BT
Fetal Bovine SerumExCell/FSP500
Pen/StrepThermo/15140-122
HygromycinGenomeditech/GM-040403
Anti-OX40L hIgG4 Antibody(Amlitelimab)Genomeditech/GM-82533AB
Description

Cell Recovery

Recovery Medium: DMEM+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: DMEM+10% FBS+1% P.S+125 μg/mL Hygromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Subculturing is necessary when the cell density reaches 80%. It is recommended to perform subculturing at a ratio of 1:3 to 1:4 every 2-3 days. Ensure that the density does not exceed 80%, as overcrowding can lead to reduced viability due to compression.

b)         Remove and discard culture medium.

c)          Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

d)         Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 30 to 60 seconds at 37°C).

e)          Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

f)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

g)         After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

h)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:3 - 1:4 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          Upon initial thawing, a higher number of dead cells is observed, which is a normal phenomenon. Significant improvement is seen after adaptation. Once the cells reach a stable state, the number of dead cells decreases after subculturing and the cell growth rate becomes stable.

b)         Ensure that the cell density does not exceed 80%, as overcrowding may lead to reduced viability due to compression.

Related products
OX40
H_OX40 Reporter Cell LineH_OX40 Reporter DDX35TM Cell LineCynomolgus_OX40L CHO-K1 Cell Line
H_OX40 CHO-K1 Cell LineH_OX40L CHO-K1 Cell Line
Anti-H_OX40 hIgG2 Antibody(Ivuxolimab)Anti-OX40L hIgG1 Reference Antibody(Oxebio)Anti-OX40L hIgG4 Antibody(Amlitelimab)
Anti-OX40L hIgG4 Reference Antibody(Amlbio)

Biotinylated Human OX40L Protein; His-Avi TagCynomolgus OX40 Protein; His TagCynomolgus OX40L Protein; His Tag
Cynomolgus OX40L Protein; mFc TagHuman OX40 Protein; His TagHuman OX40L Protein; His Tag
Human OX40L Protein; mFc Tag

IL-4/IL-13
IL-4 Reporter Cell LineIL-4/IL-13 Reporter 293 Cell LineIL-4/IL-13 Reporter 293 DDX35TM Cell Line
Cynomolgus_IL4R CHO-K1 Cell LineH_IL4R CHO-K1 Cell LineMouse_IL4R CHO-K1 Cell Line
Anti-IL-4R hIgG1 Antibody(12B5)Anti-IL4R hIgG4 Antibody(Dupilumab)Anti-IL4R hIgG4 Reference Antibody (Dupbio)
Biotinylated Human IL-4R alpha Protein; Avi-His TagCynomolgus IL-13 Protein; His TagCynomolgus IL-4R alpha Protein; His Tag
Human IL-13 Protein; His TagHuman IL-4 Protein; His TagHuman IL-4R alpha Protein; hFc Tag
Human IL-4R alpha Protein; His TagHuman IL-4R alpha Protein; mFc TagMouse IL-13 Protein; His Tag
Mouse IL-4R alpha Protein; His TagRat IL-4R alpha Protein; His Tag
IL-31
Cynomolgus_IL-31RA OSMR Reporter Baf3 Cell LineH_IL-31 Reporter Cell LineCynomolgus_IL31RA CHO-K1 Cell Line
H_IL31RA CHO-K1 Cell LineH_IL31RA HEK-293 Cell LineH_IL-31RA OSMR Baf3 Cell Line
Anti-IL31 hIgG1 Antibody(mAb33)
Anti-IL31RA hIgG1 Antibody(NA633)
Anti-IL31RA hIgG2 Antibody(Nemolizumab)
Anti-OSMR hIgG4 Antibody(Vixarelimab)
Cynomolgus IL-31 Protein; His TagHuman IL-31 Protein; His TagHuman IL-31RA Protein; hFc Tag
MRGPRX2
H_MRGPRX2 Reporter Cell LineTango-H_MRGPRX2 CHO-K1 Cell LineCynomolgus_MRGPRX2 CHO-K1 Cell Line
Cynomolgus_MRGPRX2 HEK-293 Cell LineFlag-Rat_Mrgprb3 HEK-293 Cell LineH_MRGPRX2 CHO-K1 Cell Line
H_MRGPRX2 HEK-293 Cell LineH_MRGPRX2 RBL-2H3 Cell Line
Sequence

TNFSF4(OX40L) P23510-1
MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

H_OX40L HEK-293 Cell Line
Cat. No.
GM-C35017
Size
Quote
Specifications
Data display
Materials required
Description
Related products
Sequence
Specifications
Cat. NoGM-C35017
ProductH_OX40L HEK-293 Cell Line
DescriptionH_OX40L HEK-293 Cell Line is a clonal stable HEK-293 cell line constitutively expressing human OX40L.
Product Format1 vial of frozen cells
Quantity5E6 Cells per vial,1 mL
Storage ConditionsLiquid nitrogen immediately upon receipt
TargetHuman_OX40L
Gene ID/Uniprot IDP23510-1
Host CellHEK-293
Recovery MediumDMEM+10% FBS+1% P.S
Growth mediumDMEM+10% FBS+1% P.S+125 μg/mL Hygromycin
NoteNone
Freezing Medium90% FBS+10% DMSO
Growth propertiesAdherent
Growth Conditions37°C, 5% CO₂
Safety considerationsBiosafety Level 2
Mycoplasma TestingThe cell line has been screened to confirm the absence of Mycoplasma species.
Cat. NoGM-C35017
ProductH_OX40L HEK-293 Cell Line
DescriptionH_OX40L HEK-293 Cell Line is a clonal stable HEK-293 cell line constitutively expressing human OX40L.
Product Format1 vial of frozen cells
Quantity5E6 Cells per vial,1 mL
Storage ConditionsLiquid nitrogen immediately upon receipt
TargetHuman_OX40L
Gene ID/Uniprot IDP23510-1
Host CellHEK-293
Recovery MediumDMEM+10% FBS+1% P.S
Growth mediumDMEM+10% FBS+1% P.S+125 μg/mL Hygromycin
NoteNone
Freezing Medium90% FBS+10% DMSO
Growth propertiesAdherent
Growth Conditions37°C, 5% CO₂
Safety considerationsBiosafety Level 2
Mycoplasma TestingThe cell line has been screened to confirm the absence of Mycoplasma species.
Data display
H_OX40L HEK-293 Cell Line (Cat. GM-C35017) was determined by flow cytometry using Anti-OX40L hIgG4 Antibody(Amlitelimab) (Cat. GM-82533AB).
Materials required
ReagentOrdering Information
DMEMGibco/C11995500BT
Fetal Bovine SerumExCell/FSP500
Pen/StrepThermo/15140-122
HygromycinGenomeditech/GM-040403
Anti-OX40L hIgG4 Antibody(Amlitelimab)Genomeditech/GM-82533AB
ReagentOrdering Information
DMEMGibco/C11995500BT
Fetal Bovine SerumExCell/FSP500
Pen/StrepThermo/15140-122
HygromycinGenomeditech/GM-040403
Anti-OX40L hIgG4 Antibody(Amlitelimab)Genomeditech/GM-82533AB
Description

Cell Recovery

Recovery Medium: DMEM+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: DMEM+10% FBS+1% P.S+125 μg/mL Hygromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Subculturing is necessary when the cell density reaches 80%. It is recommended to perform subculturing at a ratio of 1:3 to 1:4 every 2-3 days. Ensure that the density does not exceed 80%, as overcrowding can lead to reduced viability due to compression.

b)         Remove and discard culture medium.

c)          Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

d)         Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 30 to 60 seconds at 37°C).

e)          Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

f)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

g)         After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

h)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:3 - 1:4 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          Upon initial thawing, a higher number of dead cells is observed, which is a normal phenomenon. Significant improvement is seen after adaptation. Once the cells reach a stable state, the number of dead cells decreases after subculturing and the cell growth rate becomes stable.

b)         Ensure that the cell density does not exceed 80%, as overcrowding may lead to reduced viability due to compression.

Cell Recovery

Recovery Medium: DMEM+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: DMEM+10% FBS+1% P.S+125 μg/mL Hygromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Subculturing is necessary when the cell density reaches 80%. It is recommended to perform subculturing at a ratio of 1:3 to 1:4 every 2-3 days. Ensure that the density does not exceed 80%, as overcrowding can lead to reduced viability due to compression.

b)         Remove and discard culture medium.

c)          Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

d)         Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 30 to 60 seconds at 37°C).

e)          Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

f)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

g)         After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

h)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:3 - 1:4 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          Upon initial thawing, a higher number of dead cells is observed, which is a normal phenomenon. Significant improvement is seen after adaptation. Once the cells reach a stable state, the number of dead cells decreases after subculturing and the cell growth rate becomes stable.

b)         Ensure that the cell density does not exceed 80%, as overcrowding may lead to reduced viability due to compression.

Related products
OX40
H_OX40 Reporter Cell LineH_OX40 Reporter DDX35TM Cell LineCynomolgus_OX40L CHO-K1 Cell Line
H_OX40 CHO-K1 Cell LineH_OX40L CHO-K1 Cell Line
Anti-H_OX40 hIgG2 Antibody(Ivuxolimab)Anti-OX40L hIgG1 Reference Antibody(Oxebio)Anti-OX40L hIgG4 Antibody(Amlitelimab)
Anti-OX40L hIgG4 Reference Antibody(Amlbio)

Biotinylated Human OX40L Protein; His-Avi TagCynomolgus OX40 Protein; His TagCynomolgus OX40L Protein; His Tag
Cynomolgus OX40L Protein; mFc TagHuman OX40 Protein; His TagHuman OX40L Protein; His Tag
Human OX40L Protein; mFc Tag

IL-4/IL-13
IL-4 Reporter Cell LineIL-4/IL-13 Reporter 293 Cell LineIL-4/IL-13 Reporter 293 DDX35TM Cell Line
Cynomolgus_IL4R CHO-K1 Cell LineH_IL4R CHO-K1 Cell LineMouse_IL4R CHO-K1 Cell Line
Anti-IL-4R hIgG1 Antibody(12B5)Anti-IL4R hIgG4 Antibody(Dupilumab)Anti-IL4R hIgG4 Reference Antibody (Dupbio)
Biotinylated Human IL-4R alpha Protein; Avi-His TagCynomolgus IL-13 Protein; His TagCynomolgus IL-4R alpha Protein; His Tag
Human IL-13 Protein; His TagHuman IL-4 Protein; His TagHuman IL-4R alpha Protein; hFc Tag
Human IL-4R alpha Protein; His TagHuman IL-4R alpha Protein; mFc TagMouse IL-13 Protein; His Tag
Mouse IL-4R alpha Protein; His TagRat IL-4R alpha Protein; His Tag
IL-31
Cynomolgus_IL-31RA OSMR Reporter Baf3 Cell LineH_IL-31 Reporter Cell LineCynomolgus_IL31RA CHO-K1 Cell Line
H_IL31RA CHO-K1 Cell LineH_IL31RA HEK-293 Cell LineH_IL-31RA OSMR Baf3 Cell Line
Anti-IL31 hIgG1 Antibody(mAb33)
Anti-IL31RA hIgG1 Antibody(NA633)
Anti-IL31RA hIgG2 Antibody(Nemolizumab)
Anti-OSMR hIgG4 Antibody(Vixarelimab)
Cynomolgus IL-31 Protein; His TagHuman IL-31 Protein; His TagHuman IL-31RA Protein; hFc Tag
MRGPRX2
H_MRGPRX2 Reporter Cell LineTango-H_MRGPRX2 CHO-K1 Cell LineCynomolgus_MRGPRX2 CHO-K1 Cell Line
Cynomolgus_MRGPRX2 HEK-293 Cell LineFlag-Rat_Mrgprb3 HEK-293 Cell LineH_MRGPRX2 CHO-K1 Cell Line
H_MRGPRX2 HEK-293 Cell LineH_MRGPRX2 RBL-2H3 Cell Line
Sequence

TNFSF4(OX40L) P23510-1
MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

TNFSF4(OX40L) P23510-1
MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Message consultation
reset
submit
Message
Message consultation
reset
submit