Current position:Product Center > Cell Lines > TAA > KLK2 > Membrane bound H_KLK2(AA25-261) MC38 Cell Line (Low Expression)
Membrane bound H_KLK2(AA25-261) MC38 Cell Line (Low Expression)
Specifications
Cat. NoGM-C43639
ProductMembrane bound H_KLK2(AA25-261) MC38 Cell Line (Low Expression)
DescriptionMembrane bound H_KLK2(AA25-261) MC38 Cell Line (Low Expression) is a clonal stable MC38 cell line that constitutively expresses the human KLK2 gene, constructed using lentiviral technology.
Product Format1 vial of frozen cells
Quantity5E6 Cells per vial,1 mL
Storage ConditionsLiquid nitrogen immediately upon receipt
TargetHuman_KLK2
Gene ID/Uniprot IDP20151-1(AA Ile 25 - Pro 261)
Host CellMC38
Recovery MediumDMEM+10% FBS+1% P.S
Growth mediumDMEM+10% FBS+1% P.S+2.5 μg/mL Puromycin
NoteNone
Freezing Medium90% FBS+10% DMSO
Growth propertiesAdherent
Growth Conditions37°C, 5% CO₂
Safety considerationsBiosafety Level 2
Mycoplasma TestingThe cell line has been screened to confirm the absence of Mycoplasma species.
Data
Membrane bound H_KLK2(AA25-261) MC38 Cell Line (Low Expression) (Cat. GM-C43639) was determined by flow cytometry using Anti-KLK2 hIgG1 Antibody (Hu11B6) (Cat. GM-88129AB).
Materials
ReagentOrdering Information
DMEMGibco/C11995500BT
Fetal Bovine SerumExCell/FSP500
Pen/StrepThermo/15140-122
PuromycinGenomeditech/GM-040401
Anti-KLK2 hIgG1 Antibody(Hu11B6)Genomeditech/GM-88129AB
Cell Culture

Cell Recovery

Recovery Medium: DMEM+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: DMEM+10% FBS+1% P.S+2.5 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Remove and discard culture medium.

b)         Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

c)          Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 30 to 60 seconds at 37°C).

d)         Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

e)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

f)          After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

g)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:4 - 1:5 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          After the stabilization of the cell condition, there will be fewer dead cells post-passage, the cell growth rate will tend to stabilize, cell morphology will become uniform, and the cells will appear robust.


Sequence

KLK2 P20151-1(p.25-261)
IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP

Message Consultation
If you have more questions, please fill in the relevant information,we'll respond as soon as possible to assist you!
Reset
Submit
You can also contact us on the Scientist and Science Exchange marketplaces.
Current Position:Product Center > Cell Lines > TAA > KLK2 > Membrane bound H_KLK2(AA25-261) MC38 Cell Line (Low Expression)
classify
Membrane bound H_KLK2(AA25-261) MC38 Cell Line (Low Expression)
Specifications
Cat. NoGM-C43639
ProductMembrane bound H_KLK2(AA25-261) MC38 Cell Line (Low Expression)
DescriptionMembrane bound H_KLK2(AA25-261) MC38 Cell Line (Low Expression) is a clonal stable MC38 cell line that constitutively expresses the human KLK2 gene, constructed using lentiviral technology.
Product Format1 vial of frozen cells
Quantity5E6 Cells per vial,1 mL
Storage ConditionsLiquid nitrogen immediately upon receipt
TargetHuman_KLK2
Gene ID/Uniprot IDP20151-1(AA Ile 25 - Pro 261)
Host CellMC38
Recovery MediumDMEM+10% FBS+1% P.S
Growth mediumDMEM+10% FBS+1% P.S+2.5 μg/mL Puromycin
NoteNone
Freezing Medium90% FBS+10% DMSO
Growth propertiesAdherent
Growth Conditions37°C, 5% CO₂
Safety considerationsBiosafety Level 2
Mycoplasma TestingThe cell line has been screened to confirm the absence of Mycoplasma species.
Data
Membrane bound H_KLK2(AA25-261) MC38 Cell Line (Low Expression) (Cat. GM-C43639) was determined by flow cytometry using Anti-KLK2 hIgG1 Antibody (Hu11B6) (Cat. GM-88129AB).
Materials
ReagentOrdering Information
DMEMGibco/C11995500BT
Fetal Bovine SerumExCell/FSP500
Pen/StrepThermo/15140-122
PuromycinGenomeditech/GM-040401
Anti-KLK2 hIgG1 Antibody(Hu11B6)Genomeditech/GM-88129AB
Cell Culture

Cell Recovery

Recovery Medium: DMEM+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: DMEM+10% FBS+1% P.S+2.5 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Remove and discard culture medium.

b)         Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

c)          Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 30 to 60 seconds at 37°C).

d)         Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

e)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

f)          After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

g)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:4 - 1:5 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          After the stabilization of the cell condition, there will be fewer dead cells post-passage, the cell growth rate will tend to stabilize, cell morphology will become uniform, and the cells will appear robust.


Sequence

KLK2 P20151-1(p.25-261)
IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP

Message Consultation
If you have more questions, please fill in the relevant information,we'll respond as soon as possible to assist you!
Reset
Submit
You can also contact us on the Scientist and Science Exchange marketplaces.
Message consultation
reset
submit
Message
Message consultation
reset
submit