Current position:Product Center > Cell lines > TAA > BCMA:BAFFR:TACI > Cynomolgus_BCMA CHO-K1 Cell Line
Cynomolgus_BCMA CHO-K1 Cell Line
Product Info

Cat. NoGM-C24899

Product:Cynomolgus_BCMA CHO-K1 Cell Line

产品配图.jpg

Materials required

Cell Growth Medium:F12K+10% FBS+1% P.S+4 μg/mL Puromycin

Cell Freezing Medium:90% FBS+10% DMSO


Description

Cynomolgus BCMA amino acid sequence (A0A2K5UD97):

MLQMARQCSQNEYFDSLLHDCKPCQLRCSSTPPLTCQRYCNASMTNSVKGMNAILWTCLGLSLIISLAVFVLTFLL


Data
Related Products
Get A Quote
CD40:CD40L
H_CD40(TNFRSF5) Reporter 293 Cell LineH_CD40(TNFRSF5) Reporter Jurkat Cell LineCynomolgus_CD40 CHO-K1 Cell Line
Cynomolgus_CD40L CHO-K1 Cell LineH_CD40(TNFRSF5) CHO-K1 Cell LineH_CD40(TNFRSF5) HEK-293 Cell Line
H_CD40L CHO-K1 Cell LineH_CD40L HEK-293 Cell Line
Anti-H_CD40 hIgG1 Antibody(APX005M)Anti-H_CD40 hIgG1 Antibody(ravagalimab)Anti-H_CD40L hIgG1 Antibody(dapirolizumab)
Anti-H_CD40L hIgG1 Antibody(frexalimab)

Biotinylated Cynomolgus CD40 Protein; His-Avi TagBiotinylated Human CD40 Protein; His-Avi TagBiotinylated Human CD40L Protein; His-Avi Tag
Cynomolgus CD40 Protein; His TagHuman CD40 Protein; His TagHuman CD40L Protein; His hFc Tag
Human CD40L Protein; His Tag

IFN-α
IFNα Reporter HEK-293 Cell LineIFNα Reporter MDCK Cell LineIFNα Reporter THP1 Cell Line
BCMA:BAFFR:TACI
H_BAFFR Jurkat Blockade Reporter Cell LineH_BAFFR Reporter Cell LineH_BCMA Reporter Cell Line
H_TACI Reporter Cell LineH_BCMA CHO-K1 Cell LineH_BCMA HEK-293 Cell Line
Anti-BCMA hIgG1 Antibody(Belantamab)Anti-BCMA hIgG1 Antibody(SEA-BCMA)Anti-BCMA hIgG4 Antibody(BCMB69)
Biotinylated Human BAFF Protein; His-Avi TagCynomolgus BAFF Protein; His TagHuman BAFF Protein; His Tag
Mouse BAFF Protein; His Tag

BDCA2(CLEC4C)
H_BDCA2 Reporter Jurkat Cell LineCynomolgus_BDCA2 CHO-K1 Cell LineCynomolgus_BDCA2 Jurkat Cell Line
H_BDCA2 CHO-K1 Cell LineH_BDCA2 HEK-293 Cell LineH_BDCA2 Jurkat Cell Line
Anti-H_BDCA2 hIgG1 Antibody(Litifilimab)

Cynomolgus BDCA2 Protein; His TagHuman BDCA2 Protein; His Tag
CD3
Jurkat CD3-BsAb Reporter Cell LineCynomolgus_CD3 HEK-293 Cell LineCynomolgus_CD3E(Membrane Bound ECD) CHO-K1 Cell Line
H_CD3 CHO-K1 Cell LineH_CD3 HEK-293 Cell LineH_CD3E(Membrane Bound ECD) CHO-K1 Cell Line
Mouse_CD3 HEK-293 Cell Line

Anti-CD3 epsilon hIgG1 Antibody [OKT-3 (muromonab)]Anti-CD3 hIgG1 Antibody(CH2527)


Message Consultation
If you have more questions, please fill in the relevant information,we'll respond as soon as possible to assist you!
Reset
Submit
You can also contact us on the Scientist and Science Exchange marketplaces.
Current Position:Product Center > Cell lines > TAA > BCMA:BAFFR:TACI > Cynomolgus_BCMA CHO-K1 Cell Line
classify
Cynomolgus_BCMA CHO-K1 Cell Line
Product Info

Cat. NoGM-C24899

Product:Cynomolgus_BCMA CHO-K1 Cell Line

产品配图.jpg

Materials required

Cell Growth Medium:F12K+10% FBS+1% P.S+4 μg/mL Puromycin

Cell Freezing Medium:90% FBS+10% DMSO


Description

Cynomolgus BCMA amino acid sequence (A0A2K5UD97):

MLQMARQCSQNEYFDSLLHDCKPCQLRCSSTPPLTCQRYCNASMTNSVKGMNAILWTCLGLSLIISLAVFVLTFLL


Data
Related Products
Get A Quote
CD40:CD40L
H_CD40(TNFRSF5) Reporter 293 Cell LineH_CD40(TNFRSF5) Reporter Jurkat Cell LineCynomolgus_CD40 CHO-K1 Cell Line
Cynomolgus_CD40L CHO-K1 Cell LineH_CD40(TNFRSF5) CHO-K1 Cell LineH_CD40(TNFRSF5) HEK-293 Cell Line
H_CD40L CHO-K1 Cell LineH_CD40L HEK-293 Cell Line
Anti-H_CD40 hIgG1 Antibody(APX005M)Anti-H_CD40 hIgG1 Antibody(ravagalimab)Anti-H_CD40L hIgG1 Antibody(dapirolizumab)
Anti-H_CD40L hIgG1 Antibody(frexalimab)

Biotinylated Cynomolgus CD40 Protein; His-Avi TagBiotinylated Human CD40 Protein; His-Avi TagBiotinylated Human CD40L Protein; His-Avi Tag
Cynomolgus CD40 Protein; His TagHuman CD40 Protein; His TagHuman CD40L Protein; His hFc Tag
Human CD40L Protein; His Tag

IFN-α
IFNα Reporter HEK-293 Cell LineIFNα Reporter MDCK Cell LineIFNα Reporter THP1 Cell Line
BCMA:BAFFR:TACI
H_BAFFR Jurkat Blockade Reporter Cell LineH_BAFFR Reporter Cell LineH_BCMA Reporter Cell Line
H_TACI Reporter Cell LineH_BCMA CHO-K1 Cell LineH_BCMA HEK-293 Cell Line
Anti-BCMA hIgG1 Antibody(Belantamab)Anti-BCMA hIgG1 Antibody(SEA-BCMA)Anti-BCMA hIgG4 Antibody(BCMB69)
Biotinylated Human BAFF Protein; His-Avi TagCynomolgus BAFF Protein; His TagHuman BAFF Protein; His Tag
Mouse BAFF Protein; His Tag

BDCA2(CLEC4C)
H_BDCA2 Reporter Jurkat Cell LineCynomolgus_BDCA2 CHO-K1 Cell LineCynomolgus_BDCA2 Jurkat Cell Line
H_BDCA2 CHO-K1 Cell LineH_BDCA2 HEK-293 Cell LineH_BDCA2 Jurkat Cell Line
Anti-H_BDCA2 hIgG1 Antibody(Litifilimab)

Cynomolgus BDCA2 Protein; His TagHuman BDCA2 Protein; His Tag
CD3
Jurkat CD3-BsAb Reporter Cell LineCynomolgus_CD3 HEK-293 Cell LineCynomolgus_CD3E(Membrane Bound ECD) CHO-K1 Cell Line
H_CD3 CHO-K1 Cell LineH_CD3 HEK-293 Cell LineH_CD3E(Membrane Bound ECD) CHO-K1 Cell Line
Mouse_CD3 HEK-293 Cell Line

Anti-CD3 epsilon hIgG1 Antibody [OKT-3 (muromonab)]Anti-CD3 hIgG1 Antibody(CH2527)


Message Consultation
If you have more questions, please fill in the relevant information,we'll respond as soon as possible to assist you!
Reset
Submit
You can also contact us on the Scientist and Science Exchange marketplaces.
Message consultation
reset
submit
Message
Message consultation
reset
submit