Where Discovery Begins
Cynomolgus_BCMA CHO-K1 Cell Line
Cat. No.
GM-C24899
Size
2 vial
Quote
Product Info
Data display
Materials required
Description
Related products
Product Info

Cat. NoGM-C24899

Product:Cynomolgus_BCMA CHO-K1 Cell Line

产品配图.jpg

Data display
Cynomolgus_BCMA CHO-K1 Cell Line (Cat. GM-C24899) was determined by flow cytometry using Anti-BCMA hIgG1 Antibody(Belantamab) (Cat. GM-52396AB).
Materials required

Cell Growth Medium:F12K+10% FBS+1% P.S+4 μg/mL Puromycin

Cell Freezing Medium:90% FBS+10% DMSO


Description

Cynomolgus BCMA amino acid sequence (A0A2K5UD97):

MLQMARQCSQNEYFDSLLHDCKPCQLRCSSTPPLTCQRYCNASMTNSVKGMNAILWTCLGLSLIISLAVFVLTFLL


Related products
CD40:CD40L
H_CD40(TNFRSF5) Reporter 293 Cell Line H_CD40(TNFRSF5) Reporter Jurkat Cell Line Cynomolgus_CD40 CHO-K1 Cell Line
Cynomolgus_CD40L CHO-K1 Cell Line H_CD40(TNFRSF5) CHO-K1 Cell Line H_CD40(TNFRSF5) HEK-293 Cell Line
H_CD40L CHO-K1 Cell Line H_CD40L HEK-293 Cell Line  
Anti-H_CD40 hIgG1 Antibody Anti-H_CD40 hIgG1 Antibody Anti-H_CD40L hIgG1 Antibody
Anti-H_CD40L hIgG1 Antibody    
Biotinylated Cynomolgus CD40 Protein; His-Avi Tag Biotinylated Human CD40 Protein; His-Avi Tag Biotinylated Human CD40L Protein; His-Avi Tag
Cynomolgus CD40 Protein; His Tag Human CD40 Protein; His Tag Human CD40L Protein; His hFc Tag
Human CD40L Protein; His Tag    
IFN-α
IFNα Reporter HEK-293 Cell Line IFNα Reporter MDCK Cell Line IFNα Reporter THP1 Cell Line
BCMA:BAFFR:TACI
H_BAFFR Jurkat Blockade Reporter Cell Line H_BAFFR Reporter Cell Line H_BCMA Reporter Cell Line
H_TACI Reporter Cell Line H_BCMA CHO-K1 Cell Line H_BCMA HEK-293 Cell Line
Anti-BCMA hIgG1 Antibody Anti-BCMA hIgG1 Antibody Anti-BCMA hIgG4 Antibody
Biotinylated Human BAFF Protein; His-Avi Tag Cynomolgus BAFF Protein; His Tag Human BAFF Protein; His Tag
Mouse BAFF Protein; His Tag    
BDCA2(CLEC4C)
H_BDCA2 Reporter Jurkat Cell Line Cynomolgus_BDCA2 CHO-K1 Cell Line Cynomolgus_BDCA2 Jurkat Cell Line
H_BDCA2 CHO-K1 Cell Line H_BDCA2 HEK-293 Cell Line H_BDCA2 Jurkat Cell Line
Anti-H_BDCA2 hIgG1 Antibody    
Cynomolgus BDCA2 Protein; His Tag Human BDCA2 Protein; His Tag  
CD3
Jurkat CD3-BsAb Reporter Cell Line Cynomolgus_CD3 HEK-293 Cell Line Cynomolgus_CD3E(Membrane Bound ECD) CHO-K1 Cell Line
H_CD3 CHO-K1 Cell Line H_CD3 HEK-293 Cell Line H_CD3E(Membrane Bound ECD) CHO-K1 Cell Line
Mouse_CD3 HEK-293 Cell Line    
Anti-CD3 epsilon hIgG1 Antibody Anti-CD3 hIgG1 Antibody  

 

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.
Cynomolgus_BCMA CHO-K1 Cell Line
Cat. No.
GM-C24899
Size
2 vial
Quote
Product Info
Data display
Materials required
Description
Related products
Product Info

Cat. NoGM-C24899

Product:Cynomolgus_BCMA CHO-K1 Cell Line

产品配图.jpg

Cat. NoGM-C24899

Product:Cynomolgus_BCMA CHO-K1 Cell Line

产品配图.jpg

Data display
Cynomolgus_BCMA CHO-K1 Cell Line (Cat. GM-C24899) was determined by flow cytometry using Anti-BCMA hIgG1 Antibody(Belantamab) (Cat. GM-52396AB).
Materials required

Cell Growth Medium:F12K+10% FBS+1% P.S+4 μg/mL Puromycin

Cell Freezing Medium:90% FBS+10% DMSO


Cell Growth Medium:F12K+10% FBS+1% P.S+4 μg/mL Puromycin

Cell Freezing Medium:90% FBS+10% DMSO


Description

Cynomolgus BCMA amino acid sequence (A0A2K5UD97):

MLQMARQCSQNEYFDSLLHDCKPCQLRCSSTPPLTCQRYCNASMTNSVKGMNAILWTCLGLSLIISLAVFVLTFLL


Cynomolgus BCMA amino acid sequence (A0A2K5UD97):

MLQMARQCSQNEYFDSLLHDCKPCQLRCSSTPPLTCQRYCNASMTNSVKGMNAILWTCLGLSLIISLAVFVLTFLL


Related products
CD40:CD40L
H_CD40(TNFRSF5) Reporter 293 Cell Line H_CD40(TNFRSF5) Reporter Jurkat Cell Line Cynomolgus_CD40 CHO-K1 Cell Line
Cynomolgus_CD40L CHO-K1 Cell Line H_CD40(TNFRSF5) CHO-K1 Cell Line H_CD40(TNFRSF5) HEK-293 Cell Line
H_CD40L CHO-K1 Cell Line H_CD40L HEK-293 Cell Line  
Anti-H_CD40 hIgG1 Antibody Anti-H_CD40 hIgG1 Antibody Anti-H_CD40L hIgG1 Antibody
Anti-H_CD40L hIgG1 Antibody    
Biotinylated Cynomolgus CD40 Protein; His-Avi Tag Biotinylated Human CD40 Protein; His-Avi Tag Biotinylated Human CD40L Protein; His-Avi Tag
Cynomolgus CD40 Protein; His Tag Human CD40 Protein; His Tag Human CD40L Protein; His hFc Tag
Human CD40L Protein; His Tag    
IFN-α
IFNα Reporter HEK-293 Cell Line IFNα Reporter MDCK Cell Line IFNα Reporter THP1 Cell Line
BCMA:BAFFR:TACI
H_BAFFR Jurkat Blockade Reporter Cell Line H_BAFFR Reporter Cell Line H_BCMA Reporter Cell Line
H_TACI Reporter Cell Line H_BCMA CHO-K1 Cell Line H_BCMA HEK-293 Cell Line
Anti-BCMA hIgG1 Antibody Anti-BCMA hIgG1 Antibody Anti-BCMA hIgG4 Antibody
Biotinylated Human BAFF Protein; His-Avi Tag Cynomolgus BAFF Protein; His Tag Human BAFF Protein; His Tag
Mouse BAFF Protein; His Tag    
BDCA2(CLEC4C)
H_BDCA2 Reporter Jurkat Cell Line Cynomolgus_BDCA2 CHO-K1 Cell Line Cynomolgus_BDCA2 Jurkat Cell Line
H_BDCA2 CHO-K1 Cell Line H_BDCA2 HEK-293 Cell Line H_BDCA2 Jurkat Cell Line
Anti-H_BDCA2 hIgG1 Antibody    
Cynomolgus BDCA2 Protein; His Tag Human BDCA2 Protein; His Tag  
CD3
Jurkat CD3-BsAb Reporter Cell Line Cynomolgus_CD3 HEK-293 Cell Line Cynomolgus_CD3E(Membrane Bound ECD) CHO-K1 Cell Line
H_CD3 CHO-K1 Cell Line H_CD3 HEK-293 Cell Line H_CD3E(Membrane Bound ECD) CHO-K1 Cell Line
Mouse_CD3 HEK-293 Cell Line    
Anti-CD3 epsilon hIgG1 Antibody Anti-CD3 hIgG1 Antibody  

 

Contact
Us
Message Inquiry
reset
submit
Message
Message Inquiry
reset
submit