Where Discovery Begins
Rabbit_CD40L NIH-3T3 Cell Line
Cat. No.
GM-C42360
Size
2 vial
Quote
Specifications
Data Display
Materials
Cell Culture
Sequence
Related products
Specifications
Cat. No GM-C42360
Product Rabbit_CD40L NIH-3T3 Cell Line
Description Rabbit_CD40L NIH-3T3 Cell Line is a clonal stable NIH-3T3 cell line that constitutively expresses the Rabbit CD40L gene, constructed using lentiviral technology.
Product Format 1 vial of frozen cells
Quantity 5E6 Cells per vial,1 mL
Storage Conditions Liquid nitrogen immediately upon receipt
Target Rabbit CD40L
Gene ID/Uniprot ID G1SKP7
Host Cell NIH-3T3
Recovery Medium DMEM+10% FBS+1% P.S
Growth medium DMEM+10% FBS+1% P.S+1 μg/mL Puromycin
Note None
Freezing Medium 90% FBS+10% DMSO
Growth properties Adherent
Growth Conditions 37°C, 5% CO₂
Safety considerations Biosafety Level 2
Mycoplasma Testing The cell line has been screened to confirm the absence of Mycoplasma species.
Cat. No GM-C42360
Product Rabbit_CD40L NIH-3T3 Cell Line
Description Rabbit_CD40L NIH-3T3 Cell Line is a clonal stable NIH-3T3 cell line that constitutively expresses the Rabbit CD40L gene, constructed using lentiviral technology.
Product Format 1 vial of frozen cells
Quantity 5E6 Cells per vial,1 mL
Storage Conditions Liquid nitrogen immediately upon receipt
Target Rabbit CD40L
Gene ID/Uniprot ID G1SKP7
Host Cell NIH-3T3
Recovery Medium DMEM+10% FBS+1% P.S
Growth medium DMEM+10% FBS+1% P.S+1 μg/mL Puromycin
Note None
Freezing Medium 90% FBS+10% DMSO
Growth properties Adherent
Growth Conditions 37°C, 5% CO₂
Safety considerations Biosafety Level 2
Mycoplasma Testing The cell line has been screened to confirm the absence of Mycoplasma species.
Data Display
Expression
Rabbit_CD40L NIH-3T3 Cell Line (Cat. GM-C42360) was determined by flow cytometry using Anti-CD40L hIgG1 Reference Antibody.
Rabbit_CD40L NIH-3T3 Cell Line (Cat. GM-C42360) was determined by flow cytometry using Anti-His mIgG2a Antibody.
Materials
Reagent Ordering Information
DMEM Gibco/C11995500BT
Fetal Bovine Serum ExCell/FSP500
Pen/Strep Thermo/15140-122
Puromycin Genomeditech/GM-040401
Anti-CD40L hIgG1 Reference Antibody Genomeditech/GM-87982MAB
Anti-His mIgG2a Antibody Genomeditech/GM-59493AB
Reagent Ordering Information
DMEM Gibco/C11995500BT
Fetal Bovine Serum ExCell/FSP500
Pen/Strep Thermo/15140-122
Puromycin Genomeditech/GM-040401
Anti-CD40L hIgG1 Reference Antibody Genomeditech/GM-87982MAB
Anti-His mIgG2a Antibody Genomeditech/GM-59493AB
Cell Culture

Cell Recovery

Recovery Medium: DMEM+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: DMEM+10% FBS+1% P.S+1 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Subculturing is necessary when the cell density reaches 60%. It is recommended to perform subculturing at a ratio of 1:4 to 1:5 every 2-3 days.

b)         Remove and discard culture medium.

c)          Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

d)         Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 30 seconds at 37°C).

e)          Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

f)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

g)         After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

h)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:4 - 1:5 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          FBS needs to be heat-inactivated at 56°C for 30 minutes. This process inactivates complement proteins and some viruses, but does not significantly affect the activity of most growth factors and cytokines.

b)         Cells should never be allowed to become over-confluent. Subculturing should be performed at least twice per week to ensure that cell density does not exceed 80%.

Cell Recovery

Recovery Medium: DMEM+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: DMEM+10% FBS+1% P.S+1 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Subculturing is necessary when the cell density reaches 60%. It is recommended to perform subculturing at a ratio of 1:4 to 1:5 every 2-3 days.

b)         Remove and discard culture medium.

c)          Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

d)         Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 30 seconds at 37°C).

e)          Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

f)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

g)         After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

h)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:4 - 1:5 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          FBS needs to be heat-inactivated at 56°C for 30 minutes. This process inactivates complement proteins and some viruses, but does not significantly affect the activity of most growth factors and cytokines.

b)         Cells should never be allowed to become over-confluent. Subculturing should be performed at least twice per week to ensure that cell density does not exceed 80%.

Sequence

  CD40L-His G1SKP7:MIETYSQPTPRSVATGPSVSMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLHEDFVFMKTIQRCNKGEGSLSLLNCKEIRSQFEGFVKDIMLNKEEPKKEINFEMQKGDQDPQIAAHLISEASSKSSSVLQWAKKGYYTMSNTLVTLENGKQLKVKRQGFYYIYAQVTFCSNQEPSSQAPFIASLCLKSSGGSERILLRAANARSSSKTCEQQSIHLGGVFELQADASVFVNVTDASQVNHGTGFTSFGLLKLHHHHHH

  CD40L-His G1SKP7:MIETYSQPTPRSVATGPSVSMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLHEDFVFMKTIQRCNKGEGSLSLLNCKEIRSQFEGFVKDIMLNKEEPKKEINFEMQKGDQDPQIAAHLISEASSKSSSVLQWAKKGYYTMSNTLVTLENGKQLKVKRQGFYYIYAQVTFCSNQEPSSQAPFIASLCLKSSGGSERILLRAANARSSSKTCEQQSIHLGGVFELQADASVFVNVTDASQVNHGTGFTSFGLLKLHHHHHH

Related products
CD40:CD40L
H_CD40(TNFRSF5) Reporter 293 Cell Line H_CD40(TNFRSF5) Reporter Jurkat Cell Line Cynomolgus_CD40 CHO-K1 Cell Line
Cynomolgus_CD40L CHO-K1 Cell Line H_CD40(TNFRSF5) CHO-K1 Cell Line H_CD40(TNFRSF5) HEK-293 Cell Line
H_CD40L CHO-K1 Cell Line H_CD40L HEK-293 Cell Line Mouse_CD40L CHO-K1 Cell Line
Anti-CD40 hIgG1 Reference Antibody Anti-CD40 hIgG1 Reference Antibody  Anti-CD40L hIgG1 Reference Antibody 
Anti-H_CD40 hIgG1 Antibody Anti-H_CD40 hIgG1 Antibody Anti-H_CD40L hIgG1 Antibody
Anti-H_CD40L hIgG1 Antibody
Biotinylated Human CD40 Protein; His-Avi Tag Cynomolgus CD40 Protein; His Tag Human CD40 Protein; His Tag
Human CD40L Protein; His Tag    
IFN-α
IFNα Reporter HEK-293 Cell Line IFNα Reporter MDCK Cell Line IFNα Reporter THP1 Cell Line
BCMA:BAFFR:TACI
H_BAFFR Jurkat Blockade Reporter Cell Line H_BAFFR Reporter Cell Line H_BCMA Reporter Cell Line
H_TACI Reporter Cell Line Cynomolgus_BCMA CHO-K1 Cell Line Cynomolgus_BCMA HEK-293 Cell Line
H_BAFFR CHO-K1 Cell Line H_BCMA CHO-K1 Cell Line H_BCMA HEK-293 Cell Line
Membrane Bound H_APRIL(Trimer) HEK-293 Cell Line
Anti-BAFF hIgG1 Antibody Anti-BAFFR hIgG1 Antibody Anti-BCMA hIgG1 Antibody
Anti-BCMA hIgG1 Antibody Anti-BCMA hIgG4 Antibody Anti-CD3E×BCMA hIgG4 Reference Antibody
Anti-TNFSF13B(BAFF) hIgG1 Reference Antibody 
Biotinylated Human BAFF Protein; His-Avi Tag Biotinylated Human BCMA Protein; His-Avi Tag Cynomolgus BAFF Protein; His Tag
Cynomolgus BCMA Protein; hFc Tag Cynomolgus BCMA Protein; His Tag Human APRIL Protein; hFc Tag
Human BAFF Protein; His Tag Human BCMA Protein; hFc Tag Human BCMA Protein; His Tag
Mouse BAFF Protein; His Tag    
BDCA2(CLEC4C)
H_BDCA2 Reporter DDX35TM Jurkat Cell Line H_BDCA2 Reporter Jurkat Cell Line Cynomolgus_BDCA2 CHO-K1 Cell Line
Cynomolgus_BDCA2 Jurkat Cell Line H_BDCA2 CHO-K1 Cell Line H_BDCA2 HEK-293 Cell Line
H_BDCA2 Jurkat Cell Line
Anti-H_BDCA2 hIgG1 Antibody
Cynomolgus BDCA2 Protein; His Tag Human BDCA2 Protein; His Tag  
For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.
Rabbit_CD40L NIH-3T3 Cell Line
Rabbit_CD40L NIH-3T3 Cell Line
Cat. No.
GM-C42360
Size
2 vial
Quote
Specifications
Data Display
Materials
Cell Culture
Sequence
Related products
Specifications
Cat. No GM-C42360
Product Rabbit_CD40L NIH-3T3 Cell Line
Description Rabbit_CD40L NIH-3T3 Cell Line is a clonal stable NIH-3T3 cell line that constitutively expresses the Rabbit CD40L gene, constructed using lentiviral technology.
Product Format 1 vial of frozen cells
Quantity 5E6 Cells per vial,1 mL
Storage Conditions Liquid nitrogen immediately upon receipt
Target Rabbit CD40L
Gene ID/Uniprot ID G1SKP7
Host Cell NIH-3T3
Recovery Medium DMEM+10% FBS+1% P.S
Growth medium DMEM+10% FBS+1% P.S+1 μg/mL Puromycin
Note None
Freezing Medium 90% FBS+10% DMSO
Growth properties Adherent
Growth Conditions 37°C, 5% CO₂
Safety considerations Biosafety Level 2
Mycoplasma Testing The cell line has been screened to confirm the absence of Mycoplasma species.
Cat. No GM-C42360
Product Rabbit_CD40L NIH-3T3 Cell Line
Description Rabbit_CD40L NIH-3T3 Cell Line is a clonal stable NIH-3T3 cell line that constitutively expresses the Rabbit CD40L gene, constructed using lentiviral technology.
Product Format 1 vial of frozen cells
Quantity 5E6 Cells per vial,1 mL
Storage Conditions Liquid nitrogen immediately upon receipt
Target Rabbit CD40L
Gene ID/Uniprot ID G1SKP7
Host Cell NIH-3T3
Recovery Medium DMEM+10% FBS+1% P.S
Growth medium DMEM+10% FBS+1% P.S+1 μg/mL Puromycin
Note None
Freezing Medium 90% FBS+10% DMSO
Growth properties Adherent
Growth Conditions 37°C, 5% CO₂
Safety considerations Biosafety Level 2
Mycoplasma Testing The cell line has been screened to confirm the absence of Mycoplasma species.
Data Display
Expression
Rabbit_CD40L NIH-3T3 Cell Line (Cat. GM-C42360) was determined by flow cytometry using Anti-CD40L hIgG1 Reference Antibody.
Rabbit_CD40L NIH-3T3 Cell Line (Cat. GM-C42360) was determined by flow cytometry using Anti-His mIgG2a Antibody.
Materials
Reagent Ordering Information
DMEM Gibco/C11995500BT
Fetal Bovine Serum ExCell/FSP500
Pen/Strep Thermo/15140-122
Puromycin Genomeditech/GM-040401
Anti-CD40L hIgG1 Reference Antibody Genomeditech/GM-87982MAB
Anti-His mIgG2a Antibody Genomeditech/GM-59493AB
Reagent Ordering Information
DMEM Gibco/C11995500BT
Fetal Bovine Serum ExCell/FSP500
Pen/Strep Thermo/15140-122
Puromycin Genomeditech/GM-040401
Anti-CD40L hIgG1 Reference Antibody Genomeditech/GM-87982MAB
Anti-His mIgG2a Antibody Genomeditech/GM-59493AB
Cell Culture

Cell Recovery

Recovery Medium: DMEM+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: DMEM+10% FBS+1% P.S+1 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Subculturing is necessary when the cell density reaches 60%. It is recommended to perform subculturing at a ratio of 1:4 to 1:5 every 2-3 days.

b)         Remove and discard culture medium.

c)          Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

d)         Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 30 seconds at 37°C).

e)          Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

f)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

g)         After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

h)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:4 - 1:5 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          FBS needs to be heat-inactivated at 56°C for 30 minutes. This process inactivates complement proteins and some viruses, but does not significantly affect the activity of most growth factors and cytokines.

b)         Cells should never be allowed to become over-confluent. Subculturing should be performed at least twice per week to ensure that cell density does not exceed 80%.

Cell Recovery

Recovery Medium: DMEM+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: DMEM+10% FBS+1% P.S+1 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Subculturing is necessary when the cell density reaches 60%. It is recommended to perform subculturing at a ratio of 1:4 to 1:5 every 2-3 days.

b)         Remove and discard culture medium.

c)          Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

d)         Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 30 seconds at 37°C).

e)          Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

f)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

g)         After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

h)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:4 - 1:5 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          FBS needs to be heat-inactivated at 56°C for 30 minutes. This process inactivates complement proteins and some viruses, but does not significantly affect the activity of most growth factors and cytokines.

b)         Cells should never be allowed to become over-confluent. Subculturing should be performed at least twice per week to ensure that cell density does not exceed 80%.

Sequence

  CD40L-His G1SKP7:MIETYSQPTPRSVATGPSVSMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLHEDFVFMKTIQRCNKGEGSLSLLNCKEIRSQFEGFVKDIMLNKEEPKKEINFEMQKGDQDPQIAAHLISEASSKSSSVLQWAKKGYYTMSNTLVTLENGKQLKVKRQGFYYIYAQVTFCSNQEPSSQAPFIASLCLKSSGGSERILLRAANARSSSKTCEQQSIHLGGVFELQADASVFVNVTDASQVNHGTGFTSFGLLKLHHHHHH

  CD40L-His G1SKP7:MIETYSQPTPRSVATGPSVSMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLHEDFVFMKTIQRCNKGEGSLSLLNCKEIRSQFEGFVKDIMLNKEEPKKEINFEMQKGDQDPQIAAHLISEASSKSSSVLQWAKKGYYTMSNTLVTLENGKQLKVKRQGFYYIYAQVTFCSNQEPSSQAPFIASLCLKSSGGSERILLRAANARSSSKTCEQQSIHLGGVFELQADASVFVNVTDASQVNHGTGFTSFGLLKLHHHHHH

Related products
CD40:CD40L
H_CD40(TNFRSF5) Reporter 293 Cell Line H_CD40(TNFRSF5) Reporter Jurkat Cell Line Cynomolgus_CD40 CHO-K1 Cell Line
Cynomolgus_CD40L CHO-K1 Cell Line H_CD40(TNFRSF5) CHO-K1 Cell Line H_CD40(TNFRSF5) HEK-293 Cell Line
H_CD40L CHO-K1 Cell Line H_CD40L HEK-293 Cell Line Mouse_CD40L CHO-K1 Cell Line
Anti-CD40 hIgG1 Reference Antibody Anti-CD40 hIgG1 Reference Antibody  Anti-CD40L hIgG1 Reference Antibody 
Anti-H_CD40 hIgG1 Antibody Anti-H_CD40 hIgG1 Antibody Anti-H_CD40L hIgG1 Antibody
Anti-H_CD40L hIgG1 Antibody
Biotinylated Human CD40 Protein; His-Avi Tag Cynomolgus CD40 Protein; His Tag Human CD40 Protein; His Tag
Human CD40L Protein; His Tag    
IFN-α
IFNα Reporter HEK-293 Cell Line IFNα Reporter MDCK Cell Line IFNα Reporter THP1 Cell Line
BCMA:BAFFR:TACI
H_BAFFR Jurkat Blockade Reporter Cell Line H_BAFFR Reporter Cell Line H_BCMA Reporter Cell Line
H_TACI Reporter Cell Line Cynomolgus_BCMA CHO-K1 Cell Line Cynomolgus_BCMA HEK-293 Cell Line
H_BAFFR CHO-K1 Cell Line H_BCMA CHO-K1 Cell Line H_BCMA HEK-293 Cell Line
Membrane Bound H_APRIL(Trimer) HEK-293 Cell Line
Anti-BAFF hIgG1 Antibody Anti-BAFFR hIgG1 Antibody Anti-BCMA hIgG1 Antibody
Anti-BCMA hIgG1 Antibody Anti-BCMA hIgG4 Antibody Anti-CD3E×BCMA hIgG4 Reference Antibody
Anti-TNFSF13B(BAFF) hIgG1 Reference Antibody 
Biotinylated Human BAFF Protein; His-Avi Tag Biotinylated Human BCMA Protein; His-Avi Tag Cynomolgus BAFF Protein; His Tag
Cynomolgus BCMA Protein; hFc Tag Cynomolgus BCMA Protein; His Tag Human APRIL Protein; hFc Tag
Human BAFF Protein; His Tag Human BCMA Protein; hFc Tag Human BCMA Protein; His Tag
Mouse BAFF Protein; His Tag    
BDCA2(CLEC4C)
H_BDCA2 Reporter DDX35TM Jurkat Cell Line H_BDCA2 Reporter Jurkat Cell Line Cynomolgus_BDCA2 CHO-K1 Cell Line
Cynomolgus_BDCA2 Jurkat Cell Line H_BDCA2 CHO-K1 Cell Line H_BDCA2 HEK-293 Cell Line
H_BDCA2 Jurkat Cell Line
Anti-H_BDCA2 hIgG1 Antibody
Cynomolgus BDCA2 Protein; His Tag Human BDCA2 Protein; His Tag  
Contact
Us
Message Inquiry
reset
submit
Message
Message Inquiry
reset
submit