News
Current position:Product Center > Cell lines > Immunotherapy target > BDCA2 > H_BDCA2 Jurkat Cell Line
H_BDCA2 Jurkat Cell Line
Specifications
Cat. NoGM-C20052
ProductH_BDCA2 Jurkat Cell Line
DescriptionH_BDCA2 Jurkat Cell Line is a clonal stable Jurkat cell line that constitutively expresses the human BDCA2 and human FCER1G genes, constructed using lentiviral technology.
Product Format1 vial of frozen cells
Quantity5E6 Cells per vial,1 mL
Storage ConditionsLiquid nitrogen immediately upon receipt
TargetHuman_BDCA2 & Human_FCER1G
Gene ID/Uniprot IDQ8WTT0-1 & P30273
Host CellJurkat
Recovery MediumRPMI 1640+10% FBS+1% P.S
Growth mediumRPMI 1640+10% FBS+1% P.S+400 μg/mL G418+0.75 μg/mL Puromycin
NoteNone
Freezing Medium90% FBS+10% DMSO
Growth propertiesSuspension
Growth Conditions37°C, 5% CO₂
Safety considerationsBiosafety Level 2
Mycoplasma TestingThe cell line has been screened to confirm the absence of Mycoplasma species.
Data
H_BDCA2 Jurkat Cell Line (Cat. GM-C20052) was determined by flow cytometry using Anti-H_BDCA2 hIgG1 Antibody(Litifilimab) (Cat. GM-31294AB).
The mRNA expression levels of H_BDCA2 Jurkat Cell Line (Cat. GM-C20052) were determined by RT-qPCR.
Materials
ReagentOrdering Information
RPMI 1640VivaCell/C3010-0500
Fetal Bovine SerumExCell/FSP500
Pen/StrepThermo/15140-122
G418Genomeditech/GM-040402
PuromycinGenomeditech/GM-040401
Anti-H_BDCA2 hIgG1 Antibody(Litifilimab)Genomeditech/GM-31294AB
Cell Culture

Cell Recovery

Recovery Medium: RPMI 1640+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium. And spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended complete medium. And dispense the suspension into 1 - 2 T-25 culture flasks.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: RPMI 1640+10% FBS+1% P.S+400 μg/mL G418+0.75 μg/mL Puromycin

Approximately 48-72 hours after the initial thawing, the cells can be passaged for the first time. After this initial passage, the culture medium can be adjusted to growth medium supplemented with antibiotics. If cells are not passaged within 48 hours, it is recommended to add some fresh recovery medium and place the flask horizontally.

a)          When the cell density reaches 1.5 - 2E6 cells/mL, subculture the cells. Do not allow the cell density to exceed 2E6 cells/mL.

b)         It is recommended to use T-25 flasks for subculturing.

c)          These cells are suspension cells, and it is recommended to use the "half-medium change" method to maintain optimal cell conditions during passaging.

d)         During passaging, you can directly add fresh growth medium to the culture flask, gently pipette to resuspend the cells, and then transfer the cell suspension to a new T-25 flask for continued culture.

Subcultivation Ratio: Maintain cultures at a cell concentraion between 3E5 and 1E6 viable cells/mL.

Medium Renewal: Every 2 to 3 days

Notes

a)          These cells are sensitive to density, so please ensure that the cell density is maintained within an appropriate range during culture and subculturing.

b)         During the first passage, pay attention to the nutrient supply; if not subculturing, make sure to add fresh recovery medium every other day as needed.


Sequence

CLEC4C(BDCA2) Q8WTT0-1
MVPEEEPQDREKGLWWFQLKVWSMAVVSILLLSVCFTVSSVVPHNFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

FCER1G P30273
MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ

Message Consultation
If you have more questions, please fill in the relevant information,we'll respond as soon as possible to assist you!
Reset
Submit
You can also contact us on the Scientist and Science Exchange marketplaces.
Current Position:Product Center > Cell lines > Immunotherapy target > BDCA2 > H_BDCA2 Jurkat Cell Line
classify
H_BDCA2 Jurkat Cell Line
Specifications
Cat. NoGM-C20052
ProductH_BDCA2 Jurkat Cell Line
DescriptionH_BDCA2 Jurkat Cell Line is a clonal stable Jurkat cell line that constitutively expresses the human BDCA2 and human FCER1G genes, constructed using lentiviral technology.
Product Format1 vial of frozen cells
Quantity5E6 Cells per vial,1 mL
Storage ConditionsLiquid nitrogen immediately upon receipt
TargetHuman_BDCA2 & Human_FCER1G
Gene ID/Uniprot IDQ8WTT0-1 & P30273
Host CellJurkat
Recovery MediumRPMI 1640+10% FBS+1% P.S
Growth mediumRPMI 1640+10% FBS+1% P.S+400 μg/mL G418+0.75 μg/mL Puromycin
NoteNone
Freezing Medium90% FBS+10% DMSO
Growth propertiesSuspension
Growth Conditions37°C, 5% CO₂
Safety considerationsBiosafety Level 2
Mycoplasma TestingThe cell line has been screened to confirm the absence of Mycoplasma species.
Data
H_BDCA2 Jurkat Cell Line (Cat. GM-C20052) was determined by flow cytometry using Anti-H_BDCA2 hIgG1 Antibody(Litifilimab) (Cat. GM-31294AB).
The mRNA expression levels of H_BDCA2 Jurkat Cell Line (Cat. GM-C20052) were determined by RT-qPCR.
Materials
ReagentOrdering Information
RPMI 1640VivaCell/C3010-0500
Fetal Bovine SerumExCell/FSP500
Pen/StrepThermo/15140-122
G418Genomeditech/GM-040402
PuromycinGenomeditech/GM-040401
Anti-H_BDCA2 hIgG1 Antibody(Litifilimab)Genomeditech/GM-31294AB
Cell Culture

Cell Recovery

Recovery Medium: RPMI 1640+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium. And spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended complete medium. And dispense the suspension into 1 - 2 T-25 culture flasks.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: RPMI 1640+10% FBS+1% P.S+400 μg/mL G418+0.75 μg/mL Puromycin

Approximately 48-72 hours after the initial thawing, the cells can be passaged for the first time. After this initial passage, the culture medium can be adjusted to growth medium supplemented with antibiotics. If cells are not passaged within 48 hours, it is recommended to add some fresh recovery medium and place the flask horizontally.

a)          When the cell density reaches 1.5 - 2E6 cells/mL, subculture the cells. Do not allow the cell density to exceed 2E6 cells/mL.

b)         It is recommended to use T-25 flasks for subculturing.

c)          These cells are suspension cells, and it is recommended to use the "half-medium change" method to maintain optimal cell conditions during passaging.

d)         During passaging, you can directly add fresh growth medium to the culture flask, gently pipette to resuspend the cells, and then transfer the cell suspension to a new T-25 flask for continued culture.

Subcultivation Ratio: Maintain cultures at a cell concentraion between 3E5 and 1E6 viable cells/mL.

Medium Renewal: Every 2 to 3 days

Notes

a)          These cells are sensitive to density, so please ensure that the cell density is maintained within an appropriate range during culture and subculturing.

b)         During the first passage, pay attention to the nutrient supply; if not subculturing, make sure to add fresh recovery medium every other day as needed.


Sequence

CLEC4C(BDCA2) Q8WTT0-1
MVPEEEPQDREKGLWWFQLKVWSMAVVSILLLSVCFTVSSVVPHNFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

FCER1G P30273
MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ

Message Consultation
If you have more questions, please fill in the relevant information,we'll respond as soon as possible to assist you!
Reset
Submit
You can also contact us on the Scientist and Science Exchange marketplaces.
Message consultation
reset
submit
Service
Message
Message consultation
reset
submit