H_CDH17(ΔEC1-5,Flag-EC6-7) HEK-293 Cell Line
Cat. No.
GM-C31207
Size
Quote
Specifications
Data display
Materials
Cell Culture
Related products
Sequence
Specifications
Cat. NoGM-C31207
ProductH_CDH17(ΔEC1-5,Flag-EC6-7) HEK-293 Cell Line
DescriptionH_CDH17(ΔEC1-5,Flag-EC6-7) HEK-293 Cell Line is a clonal stable HEK-293 cell line constitutively expressing human CDH17.
Product Format1 vial of frozen cells
Quantity5E6 Cells per vial,1 mL
Storage ConditionsLiquid nitrogen immediately upon receipt
TargetHuman_CDH17(ΔEC1-5,Flag-EC6-7) & N-Flag
Gene ID/Uniprot IDQ12864(AA Ser 567 - Gly 777;AA Ala 788 - Ser 832)
Host CellHEK-293
Recovery MediumDMEM+10% FBS+1% P.S
Growth mediumDMEM+10% FBS+1% P.S+0.75 μg/mL Puromycin
NoteNone
Freezing Medium90% FBS+10% DMSO
Growth propertiesAdherent
Growth Conditions37°C, 5% CO₂
Safety considerationsBiosafety Level 2
Mycoplasma TestingThe cell line has been screened to confirm the absence of Mycoplasma species.
Data display
H_CDH17(ΔEC1-5,Flag-EC6-7) HEK-293 Cell Line (Cat. GM-C31207) was determined by flow cytometry using Anti-Flag mIgG1 Antibody (Cat. GM-30726AB).
The passage stability of the H_CDH17(ΔEC1-5,Flag-EC6-7) HEK-293 Cell Line (Cat. GM-C31207) was determined by flow cytometry using Anti-Flag mIgG1 Antibody (Cat. GM-30726AB).
Materials
ReagentOrdering Information
PuromycinGenomeditech/GM-040401
Pen/StrepThermo/15140-122
Fetal Bovine SerumExCell/FSP500
DMEMGibco/C11995500BT
Anti-Flag mIgG1 AntibodyGenomeditech/GM-30726AB
Cell Culture

Cell Recovery

Recovery Medium: DMEM+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: DMEM+10% FBS+1% P.S+0.75 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Subculturing is necessary when the cell density reaches 80%. It is recommended to perform subculturing at a ratio of 1:3 to 1:4 every 2-3 days. Ensure that the density does not exceed 80%, as overcrowding can lead to reduced viability due to compression.

b)         Remove and discard culture medium.

c)          Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

d)         Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 30 to 60 seconds at 37°C).

e)          Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

f)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

g)         After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

h)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:3 - 1:4 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          Upon initial thawing, a higher number of dead cells is observed, which is a normal phenomenon. Significant improvement is seen after adaptation. Once the cells reach a stable state, the number of dead cells decreases after subculturing and the cell growth rate becomes stable.

b)         Ensure that the cell density does not exceed 80%, as overcrowding may lead to reduced viability due to compression.


Sequence

Flag-CDH17 Q12864(AA Ser 567 - Gly 777;AA Ala 788 - Ser 832)
DYKDDDDKGSSQHVFQAKVSEDVAIGTKVGNVTAKDPEGLDISYSLRGDTRGWLKIDHVTGEIFSVAPLDREAGSPYRVQVVATEVGGSSLSSVSEFHLILMDVNDNPPRLAKDYTGLFFCHPLSAPGSLIFEATDDDQHLFRGPHFTFSLGSGSLQNDWEVSKINGTHARLSTRHTEFEEREYVVLIRINDGGRPPLEGIVSLPVTFCSCVEGSCFRPAG - AVGILLTTLLVIGIILAVVFIRIKKDKGKDNVESAQASEVKPLRS

H_CDH17(ΔEC1-5,Flag-EC6-7) HEK-293 Cell Line
Cat. No.
GM-C31207
Size
Quote
Specifications
Data display
Materials
Cell Culture
Related products
Sequence
Specifications
Cat. NoGM-C31207
ProductH_CDH17(ΔEC1-5,Flag-EC6-7) HEK-293 Cell Line
DescriptionH_CDH17(ΔEC1-5,Flag-EC6-7) HEK-293 Cell Line is a clonal stable HEK-293 cell line constitutively expressing human CDH17.
Product Format1 vial of frozen cells
Quantity5E6 Cells per vial,1 mL
Storage ConditionsLiquid nitrogen immediately upon receipt
TargetHuman_CDH17(ΔEC1-5,Flag-EC6-7) & N-Flag
Gene ID/Uniprot IDQ12864(AA Ser 567 - Gly 777;AA Ala 788 - Ser 832)
Host CellHEK-293
Recovery MediumDMEM+10% FBS+1% P.S
Growth mediumDMEM+10% FBS+1% P.S+0.75 μg/mL Puromycin
NoteNone
Freezing Medium90% FBS+10% DMSO
Growth propertiesAdherent
Growth Conditions37°C, 5% CO₂
Safety considerationsBiosafety Level 2
Mycoplasma TestingThe cell line has been screened to confirm the absence of Mycoplasma species.
Cat. NoGM-C31207
ProductH_CDH17(ΔEC1-5,Flag-EC6-7) HEK-293 Cell Line
DescriptionH_CDH17(ΔEC1-5,Flag-EC6-7) HEK-293 Cell Line is a clonal stable HEK-293 cell line constitutively expressing human CDH17.
Product Format1 vial of frozen cells
Quantity5E6 Cells per vial,1 mL
Storage ConditionsLiquid nitrogen immediately upon receipt
TargetHuman_CDH17(ΔEC1-5,Flag-EC6-7) & N-Flag
Gene ID/Uniprot IDQ12864(AA Ser 567 - Gly 777;AA Ala 788 - Ser 832)
Host CellHEK-293
Recovery MediumDMEM+10% FBS+1% P.S
Growth mediumDMEM+10% FBS+1% P.S+0.75 μg/mL Puromycin
NoteNone
Freezing Medium90% FBS+10% DMSO
Growth propertiesAdherent
Growth Conditions37°C, 5% CO₂
Safety considerationsBiosafety Level 2
Mycoplasma TestingThe cell line has been screened to confirm the absence of Mycoplasma species.
Data display
H_CDH17(ΔEC1-5,Flag-EC6-7) HEK-293 Cell Line (Cat. GM-C31207) was determined by flow cytometry using Anti-Flag mIgG1 Antibody (Cat. GM-30726AB).
The passage stability of the H_CDH17(ΔEC1-5,Flag-EC6-7) HEK-293 Cell Line (Cat. GM-C31207) was determined by flow cytometry using Anti-Flag mIgG1 Antibody (Cat. GM-30726AB).
Materials
ReagentOrdering Information
PuromycinGenomeditech/GM-040401
Pen/StrepThermo/15140-122
Fetal Bovine SerumExCell/FSP500
DMEMGibco/C11995500BT
Anti-Flag mIgG1 AntibodyGenomeditech/GM-30726AB
ReagentOrdering Information
PuromycinGenomeditech/GM-040401
Pen/StrepThermo/15140-122
Fetal Bovine SerumExCell/FSP500
DMEMGibco/C11995500BT
Anti-Flag mIgG1 AntibodyGenomeditech/GM-30726AB
Cell Culture

Cell Recovery

Recovery Medium: DMEM+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: DMEM+10% FBS+1% P.S+0.75 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Subculturing is necessary when the cell density reaches 80%. It is recommended to perform subculturing at a ratio of 1:3 to 1:4 every 2-3 days. Ensure that the density does not exceed 80%, as overcrowding can lead to reduced viability due to compression.

b)         Remove and discard culture medium.

c)          Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

d)         Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 30 to 60 seconds at 37°C).

e)          Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

f)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

g)         After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

h)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:3 - 1:4 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          Upon initial thawing, a higher number of dead cells is observed, which is a normal phenomenon. Significant improvement is seen after adaptation. Once the cells reach a stable state, the number of dead cells decreases after subculturing and the cell growth rate becomes stable.

b)         Ensure that the cell density does not exceed 80%, as overcrowding may lead to reduced viability due to compression.


Cell Recovery

Recovery Medium: DMEM+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: DMEM+10% FBS+1% P.S+0.75 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Subculturing is necessary when the cell density reaches 80%. It is recommended to perform subculturing at a ratio of 1:3 to 1:4 every 2-3 days. Ensure that the density does not exceed 80%, as overcrowding can lead to reduced viability due to compression.

b)         Remove and discard culture medium.

c)          Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

d)         Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 30 to 60 seconds at 37°C).

e)          Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

f)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

g)         After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

h)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:3 - 1:4 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          Upon initial thawing, a higher number of dead cells is observed, which is a normal phenomenon. Significant improvement is seen after adaptation. Once the cells reach a stable state, the number of dead cells decreases after subculturing and the cell growth rate becomes stable.

b)         Ensure that the cell density does not exceed 80%, as overcrowding may lead to reduced viability due to compression.


Sequence

Flag-CDH17 Q12864(AA Ser 567 - Gly 777;AA Ala 788 - Ser 832)
DYKDDDDKGSSQHVFQAKVSEDVAIGTKVGNVTAKDPEGLDISYSLRGDTRGWLKIDHVTGEIFSVAPLDREAGSPYRVQVVATEVGGSSLSSVSEFHLILMDVNDNPPRLAKDYTGLFFCHPLSAPGSLIFEATDDDQHLFRGPHFTFSLGSGSLQNDWEVSKINGTHARLSTRHTEFEEREYVVLIRINDGGRPPLEGIVSLPVTFCSCVEGSCFRPAG - AVGILLTTLLVIGIILAVVFIRIKKDKGKDNVESAQASEVKPLRS

Flag-CDH17 Q12864(AA Ser 567 - Gly 777;AA Ala 788 - Ser 832)
DYKDDDDKGSSQHVFQAKVSEDVAIGTKVGNVTAKDPEGLDISYSLRGDTRGWLKIDHVTGEIFSVAPLDREAGSPYRVQVVATEVGGSSLSSVSEFHLILMDVNDNPPRLAKDYTGLFFCHPLSAPGSLIFEATDDDQHLFRGPHFTFSLGSGSLQNDWEVSKINGTHARLSTRHTEFEEREYVVLIRINDGGRPPLEGIVSLPVTFCSCVEGSCFRPAG - AVGILLTTLLVIGIILAVVFIRIKKDKGKDNVESAQASEVKPLRS

Message consultation
reset
submit
Message
Message consultation
reset
submit