News
Current position:Product Center > Cell lines > Immune checkpoints > CD24-Siglec10 > H_CD24 HEK-293 Cell Line
H_CD24 HEK-293 Cell Line
Specifications
Cat. NoGM-C03872
ProductH_CD24 HEK-293 Cell Line
DescriptionH_CD24 HEK-293 Cell Line is a clonal stable HEK-293 cell line that constitutively expresses the human CD24 gene, constructed using lentiviral technology.
Product Format1 vial of frozen cells
Quantity5E6 Cells per vial,1 mL
Storage ConditionsLiquid nitrogen immediately upon receipt
TargetHuman_CD24
Gene ID/Uniprot IDP25063-1
Host CellHEK-293
Recovery MediumDMEM+10% FBS+1% P.S
Growth mediumDMEM+10% FBS+1% P.S+0.75 μg/mL Puromycin
NoteCells should be cultured using gibco/C11995500BT medium or Growth medium from Genomeditech. The serum should be Cegrogen biotech/A0500-3010 or sourced from Gibco.
Freezing Medium90% FBS+10% DMSO
Growth propertiesAdherent
Growth Conditions37°C, 5% CO₂
Safety considerationsBiosafety Level 2
Mycoplasma TestingThe cell line has been screened to confirm the absence of Mycoplasma species.
Data
H_CD24 HEK-293 Cell Line (Cat. GM-C03872) was determined by flow cytometry using Anti-H_CD24 hIgG Antibody (In house).
H_CD24 HEK-293 Cell Line (Cat. GM-C03872) was determined by flow cytometry using Anti-CD24 hIgG1 Antibody(LM-109) (Cat. GM-82520AB).
The passage stability of the H_CD24 HEK-293 Cell Line (Cat. GM-C03872) was determined by flow cytometry using Anti-CD24 hIgG1 Antibody(LM-109) (Cat. GM-82520AB).
Materials
ReagentOrdering Information
DMEMGibco/C11995500BT
Fetal Bovine SerumCegrogen biotech/A0500-3010
Pen/StrepThermo/15140-122
PuromycinGenomeditech/GM-040401
Anti-H_CD24 hIgG AntibodyIn house/
Anti-CD24 hIgG1 Antibody(LM-109)Genomeditech/GM-82520AB
Cell Culture

Cell Recovery

Recovery Medium: DMEM+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: DMEM+10% FBS+1% P.S+0.75 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Remove and discard culture medium.

b)         Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

c)          Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 30 to 60 seconds at 37°C).

d)         Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

e)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

f)          After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

g)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:3 - 1:4 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          Upon initial revival, a higher number of dead cells and poor adherence are observed, which is normal. Adherence typically recovers within 2 - 3 days. After 2 - 3 passages, the proportion of adherent cells increases, and the cells begin to spread normally.

b)         After each passage, there may be 5-10% dead cells; however, as the number of passages increases, the recovery rate accelerates, the proportion of dead cells decreases, and the cell growth rate stabilizes.

c)          It is recommended to retain cell images after revival and during each observation to assist in assessing cell status. In case of abnormalities, promptly communicate with Geomeditech sales.

 


Sequence

CD24 P25063-1
MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS*

Current Position:Product Center > Cell lines > Immune checkpoints > CD24-Siglec10 > H_CD24 HEK-293 Cell Line
classify
H_CD24 HEK-293 Cell Line
Specifications
Cat. NoGM-C03872
ProductH_CD24 HEK-293 Cell Line
DescriptionH_CD24 HEK-293 Cell Line is a clonal stable HEK-293 cell line that constitutively expresses the human CD24 gene, constructed using lentiviral technology.
Product Format1 vial of frozen cells
Quantity5E6 Cells per vial,1 mL
Storage ConditionsLiquid nitrogen immediately upon receipt
TargetHuman_CD24
Gene ID/Uniprot IDP25063-1
Host CellHEK-293
Recovery MediumDMEM+10% FBS+1% P.S
Growth mediumDMEM+10% FBS+1% P.S+0.75 μg/mL Puromycin
NoteCells should be cultured using gibco/C11995500BT medium or Growth medium from Genomeditech. The serum should be Cegrogen biotech/A0500-3010 or sourced from Gibco.
Freezing Medium90% FBS+10% DMSO
Growth propertiesAdherent
Growth Conditions37°C, 5% CO₂
Safety considerationsBiosafety Level 2
Mycoplasma TestingThe cell line has been screened to confirm the absence of Mycoplasma species.
Data
H_CD24 HEK-293 Cell Line (Cat. GM-C03872) was determined by flow cytometry using Anti-H_CD24 hIgG Antibody (In house).
H_CD24 HEK-293 Cell Line (Cat. GM-C03872) was determined by flow cytometry using Anti-CD24 hIgG1 Antibody(LM-109) (Cat. GM-82520AB).
The passage stability of the H_CD24 HEK-293 Cell Line (Cat. GM-C03872) was determined by flow cytometry using Anti-CD24 hIgG1 Antibody(LM-109) (Cat. GM-82520AB).
Materials
ReagentOrdering Information
DMEMGibco/C11995500BT
Fetal Bovine SerumCegrogen biotech/A0500-3010
Pen/StrepThermo/15140-122
PuromycinGenomeditech/GM-040401
Anti-H_CD24 hIgG AntibodyIn house/
Anti-CD24 hIgG1 Antibody(LM-109)Genomeditech/GM-82520AB
Cell Culture

Cell Recovery

Recovery Medium: DMEM+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: DMEM+10% FBS+1% P.S+0.75 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Remove and discard culture medium.

b)         Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

c)          Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 30 to 60 seconds at 37°C).

d)         Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

e)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

f)          After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

g)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:3 - 1:4 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          Upon initial revival, a higher number of dead cells and poor adherence are observed, which is normal. Adherence typically recovers within 2 - 3 days. After 2 - 3 passages, the proportion of adherent cells increases, and the cells begin to spread normally.

b)         After each passage, there may be 5-10% dead cells; however, as the number of passages increases, the recovery rate accelerates, the proportion of dead cells decreases, and the cell growth rate stabilizes.

c)          It is recommended to retain cell images after revival and during each observation to assist in assessing cell status. In case of abnormalities, promptly communicate with Geomeditech sales.

 


Sequence

CD24 P25063-1
MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS*

Tel: 400-627-9288
Message consultation
reset
submit
Service
WhatApp
Phone
Message
Message consultation
reset
submit