Current Position: Product Center
H_PGLYRP1 HEK-293 Cell Line
Cat. No.
GM-C41231
Size
1 Tube
Quote
Specifications
Data Display
Materials
Cell Culture
Sequence
Related products
Specifications
Cat. No GM-C41231
Product H_PGLYRP1 HEK-293 Cell Line
Description H_PGLYRP1 HEK-293 Cell Line is a clonal stable HEK-293 cell line that constitutively expresses the human PGLYRP1 gene, constructed using lentiviral technology.
Product Format 1 vial of frozen cells
Quantity 5E6 Cells per vial,1 mL
Storage Conditions Liquid nitrogen immediately upon receipt
Target H_PGLYRP1
Gene ID/Uniprot ID Q9NY25-1 2000-10-01 v1
Host Cell HEK-293
Recovery Medium DMEM+10% FBS+1% P.S
Growth medium DMEM+10% FBS+1% P.S+0.75 μg/mL Puromycin
Note None
Freezing Medium 90% FBS+10% DMSO
Growth properties Adherent
Growth Conditions 37°C, 5% CO₂
Safety considerations Biosafety Level 2
Mycoplasma Testing The cell line has been screened to confirm the absence of Mycoplasma species.
Data Display
Expression
The mRNA expression levels of H_PGLYRP1 in the H_PGLYRP1 HEK-293 Cell Line (Cat. GM-C41231) were determined by RT-qPCR.
Assay Performance
Response to H_TREM1 Blockade Reporter Jurkat Cell Line. The H_PGLYRP1 HEK-293 Cell Line (Cat. GM-C41231) at a concentration of 5E4 cells/well was co-cultured with H_TREM1 Blockade Reporter Jurkat Cell Line (Cat. GM-C15720) at a concentration of 1E5 cells/well,in assay buffer (RPMI 1640 + 1% FBS + 1% P.S) for 6 hours (96-well format). The firefly luciferase activity was measured using the GMOne-Step Luciferase Reporter Gene Assay Kit (Cat. GM-040503). The maximum induction fold was approximately [79.1].
Signaling Pathway
Response of Antagonist in H_TREM1 Blockade Reporter Jurkat Cell Line. H_PGLYRP1 HEK-293 Cell Line (Cat. GM-C41231) was seeded at a density of 1.5E4 cells per well in a 96-well plate and incubated overnight. The next day, serial dilutions of the Anti-TREM1 hIgG1 Antibody(mAb0170) (Cat. GM-26834AB) were incubated with 1E5 cells/well of the H_TREM1 Blockade Reporter Jurkat Cell Line (Cat. GM-C15720) in a 96-well plate for 1 hour, and then added to the pre-seeded cells. The mixture was incubated for an additional 6 hours. Firefly luciferase activity was then measured using the Luciferase Reporter Assay Kit (Genomeditech). The results indicated a maximum blocking fold of approximately [81.4]. Data are shown by drug mass concentration.
Materials
Reagent Ordering Information
Puromycin Genomeditech/GM-040401
Pen/Strep Thermo/15140-122
Fetal Bovine Serum ExCell/FSP500
DMEM Gibco/C11995500BT
Anti-TREM1 hIgG1 Antibody(mAb0170) Genomeditech/GM-26834AB
H_TREM1 Blockade Reporter Jurkat Cell Line Genomeditech/GM-C15720
Cell Culture

Cell Recovery

Recovery Medium: DMEM+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: DMEM+10% FBS+1% P.S+0.75 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Subculturing is necessary when the cell density reaches 80%. It is recommended to perform subculturing at a ratio of 1:3 to 1:4 every 2-3 days. Ensure that the density does not exceed 80%, as overcrowding can lead to reduced viability due to compression.

b)         Remove and discard culture medium.

c)          Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

d)         Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 30 to 60 seconds at 37°C).

e)          Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

f)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

g)         After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

h)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:3 - 1:4 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          Upon initial thawing, a higher number of dead cells is observed, which is a normal phenomenon. Significant improvement is seen after adaptation. Once the cells reach a stable state, the number of dead cells decreases after subculturing and the cell growth rate becomes stable.

b)         Ensure that the cell density does not exceed 80%, as overcrowding may lead to reduced viability due to compression.

Sequence

PGLYRP1 O75594 1998-11-01 v1
MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP

H_PGLYRP1 HEK-293 Cell Line
Cat. No.
GM-C41231
Size
1 Tube
Quote
Specifications
Data Display
Materials
Cell Culture
Sequence
Related products
Specifications
Cat. No GM-C41231
Product H_PGLYRP1 HEK-293 Cell Line
Description H_PGLYRP1 HEK-293 Cell Line is a clonal stable HEK-293 cell line that constitutively expresses the human PGLYRP1 gene, constructed using lentiviral technology.
Product Format 1 vial of frozen cells
Quantity 5E6 Cells per vial,1 mL
Storage Conditions Liquid nitrogen immediately upon receipt
Target H_PGLYRP1
Gene ID/Uniprot ID Q9NY25-1 2000-10-01 v1
Host Cell HEK-293
Recovery Medium DMEM+10% FBS+1% P.S
Growth medium DMEM+10% FBS+1% P.S+0.75 μg/mL Puromycin
Note None
Freezing Medium 90% FBS+10% DMSO
Growth properties Adherent
Growth Conditions 37°C, 5% CO₂
Safety considerations Biosafety Level 2
Mycoplasma Testing The cell line has been screened to confirm the absence of Mycoplasma species.
Data Display
Expression
The mRNA expression levels of H_PGLYRP1 in the H_PGLYRP1 HEK-293 Cell Line (Cat. GM-C41231) were determined by RT-qPCR.
Assay Performance
Response to H_TREM1 Blockade Reporter Jurkat Cell Line. The H_PGLYRP1 HEK-293 Cell Line (Cat. GM-C41231) at a concentration of 5E4 cells/well was co-cultured with H_TREM1 Blockade Reporter Jurkat Cell Line (Cat. GM-C15720) at a concentration of 1E5 cells/well,in assay buffer (RPMI 1640 + 1% FBS + 1% P.S) for 6 hours (96-well format). The firefly luciferase activity was measured using the GMOne-Step Luciferase Reporter Gene Assay Kit (Cat. GM-040503). The maximum induction fold was approximately [79.1].
Signaling Pathway
Response of Antagonist in H_TREM1 Blockade Reporter Jurkat Cell Line. H_PGLYRP1 HEK-293 Cell Line (Cat. GM-C41231) was seeded at a density of 1.5E4 cells per well in a 96-well plate and incubated overnight. The next day, serial dilutions of the Anti-TREM1 hIgG1 Antibody(mAb0170) (Cat. GM-26834AB) were incubated with 1E5 cells/well of the H_TREM1 Blockade Reporter Jurkat Cell Line (Cat. GM-C15720) in a 96-well plate for 1 hour, and then added to the pre-seeded cells. The mixture was incubated for an additional 6 hours. Firefly luciferase activity was then measured using the Luciferase Reporter Assay Kit (Genomeditech). The results indicated a maximum blocking fold of approximately [81.4]. Data are shown by drug mass concentration.
Materials
Reagent Ordering Information
Puromycin Genomeditech/GM-040401
Pen/Strep Thermo/15140-122
Fetal Bovine Serum ExCell/FSP500
DMEM Gibco/C11995500BT
Anti-TREM1 hIgG1 Antibody(mAb0170) Genomeditech/GM-26834AB
H_TREM1 Blockade Reporter Jurkat Cell Line Genomeditech/GM-C15720
Cell Culture

Cell Recovery

Recovery Medium: DMEM+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: DMEM+10% FBS+1% P.S+0.75 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Subculturing is necessary when the cell density reaches 80%. It is recommended to perform subculturing at a ratio of 1:3 to 1:4 every 2-3 days. Ensure that the density does not exceed 80%, as overcrowding can lead to reduced viability due to compression.

b)         Remove and discard culture medium.

c)          Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

d)         Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 30 to 60 seconds at 37°C).

e)          Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

f)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

g)         After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

h)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:3 - 1:4 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          Upon initial thawing, a higher number of dead cells is observed, which is a normal phenomenon. Significant improvement is seen after adaptation. Once the cells reach a stable state, the number of dead cells decreases after subculturing and the cell growth rate becomes stable.

b)         Ensure that the cell density does not exceed 80%, as overcrowding may lead to reduced viability due to compression.

Sequence

PGLYRP1 O75594 1998-11-01 v1
MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP

Message consultation
reset
submit
Message
Message consultation
reset
submit