H_FOLH1(PSMA) PC-3 Cell Line
Cat. No.
GM-C35058
Size
1 Tube
Quote
Specifications
Data Display
Materials
Cell Culture
Sequence
Related products
Specifications
Cat. No GM-C35058
Product H_FOLH1(PSMA) PC-3 Cell Line
Description H_FOLH1(PSMA) PC-3 Cell Line is a clonal stable PC-3 cell line that constitutively expresses the human FOLH1(PSMA) gene, constructed using lentiviral technology.
Product Format 1 vial of frozen cells
Quantity 5E6 Cells per vial,1 mL
Storage Conditions Liquid nitrogen immediately upon receipt
Target H_FOLH1(PSMA)
Gene ID/Uniprot ID Q04609-1 1994-06-01 v1
Host Cell PC-3 Cell Line
Recovery Medium F12K+10% FBS+1% P.S
Growth medium F12K+10% FBS+1% P.S+0.5 μg/mL Puromycin
Note None
Freezing Medium 90% FBS+10% DMSO
Growth properties Adherent
Growth Conditions 37°C, 5% CO₂
Safety considerations Biosafety Level 2
Mycoplasma Testing The cell line has been screened to confirm the absence of Mycoplasma species.
Data Display
Expression
H_FOLH1(PSMA) PC-3 Cell Line (Cat. GM-C35058) was determined by flow cytometry using Anti-FOLH1(PSMA) hIgG1 Reference Antibody (Rosobio) (Cat. GM-87705MAB).
Assay Performance
Tumor growth curves of H_FOLH1(PSMA) PC-3 in BALB/c nude mice. H_FOLH1(PSMA) PC-3 cells (1×10^6 per mouse) were subcutaneously inoculated into BALB/c nude mice (male, 8 weeks old, n = 3). Tumor volume was measured twice per week and is presented as mean ± SEM.
Body weight changes after implantation of H_FOLH1(PSMA) PC-3 in BALB/c nude mice. Under the same conditions, body weight was measured twice per week and is presented as mean ± SEM.
Materials
Reagent Ordering Information
Puromycin Genomeditech/GM-040401
Pen/Strep Thermo/15140-122
Fetal Bovine Serum ExCell/FSP500
F12K BOSTER/PYG0036
Anti-FOLH1(PSMA) hIgG1 Reference Antibody  Genomeditech/GM-87705MAB
Cell Culture

Cell Recovery

Recovery Medium: F12K+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 3E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: F12K+10% FBS+1% P.S+0.5 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Subculturing is necessary when the cell density reaches 90%. It is recommended to perform subculturing at a ratio of 1:3 to 1:4 every 2-3 days. Ensure that the density does not exceed 90%, as overcrowding can lead to reduced viability due to compression.

b)         Remove and discard culture medium.

c)          Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

d)         Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 2 to 3 minutes at 37°C).

e)          Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

f)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

g)         After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

h)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:3 - 1:4 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          It is normal to observe a number of dead cells immediately after thawing. The condition will improve significantly after adjustment. Once the cells stabilize, the number of dead cells will decrease after subculturing, and the cell growth rate will become stable.

b)         Ensure that the cell density does not exceed 90%, as overcrowding may lead to reduced viability due to compression.

c)          FBS should be heat-inactivated at 56°C for 30 minutes to inactivate complement and certain viruses, with minimal impact on most growth factor and cytokine activities.

Sequence

PSMA Q04609-1
MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA

Related products
FOLH1(PSMA)
Cynomolgus_FOLH1(PSMA) CHO-K1 Cell Line H_FOLH1(PSMA) CHO-K1 Cell Line H_FOLH1(PSMA) HEK-293 Cell Line
H_FOLH1(PSMA) RM-1 Cell Line
Anti-FOLH1(PSMA) hIgG1 Antibody Anti-FOLH1(PSMA) hIgG1 Reference Antibody 
Cynomolgus FOLH1(PSMA) Protein; His Tag    
ADC Related Product
Anti-DXD Mouse IgG1 Antibody  Anti-DXD Mouse IgG1 Antibody  Anti-Dxd Mouse IgG2a Antibody 
Anti-Eribulin Mouse IgG2a Antibody  Anti-MMAE Mouse IgG1 Antibody  Anti-MMAE Mouse IgG2a Antibody 
Anti-MMAE Mouse IgG2a Antibody  Anti-SN38 Mouse IgG1 Antibody Mouse anti Human IgG1-DXD
Mouse anti Human IgG1-MMAE Human IgG1 Isotype-DXD (Dar8) Human IgG1 Isotype-Eribulin (Dar4)
Human IgG1 Isotype-MMAE (Dar4)
Recombinant DT3C Protein    
KLK2 KLK3
Membrane bound H_KLK2(AA19-261) CHO-K1 Cell Line Membrane bound H_KLK2(AA19-261) HEK-293 Cell Line Membrane bound H_KLK2(AA19-261) LnCap Cell Line
Membrane bound H_KLK2(AA25-261) CHO-K1 Cell Line Membrane bound H_KLK2(AA25-261) CT26 Cell Line Membrane bound H_KLK2(AA25-261) HEK-293 Cell Line
Membrane bound H_KLK2(AA25-261) MC38 Cell Line (Low Expression)
Anti-KLK2 hIgG1 Antibody
Biotinylated Human KLK2 Protein; His-Avi Tag    
ACP3
Flag-H_ACP3 HCT116 Cell Line Flag-H_ACP3 HT-1080 Cell Line H_ACP3 HCT116 Cell Line
H_ACP3 HT-1080 Cell Line H_ACP3 PC-3 Cell Line  
For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.
H_FOLH1(PSMA) PC-3 Cell Line
Cat. No.
GM-C35058
Size
1 Tube
Quote
Specifications
Data Display
Materials
Cell Culture
Sequence
Related products
Specifications
Cat. No GM-C35058
Product H_FOLH1(PSMA) PC-3 Cell Line
Description H_FOLH1(PSMA) PC-3 Cell Line is a clonal stable PC-3 cell line that constitutively expresses the human FOLH1(PSMA) gene, constructed using lentiviral technology.
Product Format 1 vial of frozen cells
Quantity 5E6 Cells per vial,1 mL
Storage Conditions Liquid nitrogen immediately upon receipt
Target H_FOLH1(PSMA)
Gene ID/Uniprot ID Q04609-1 1994-06-01 v1
Host Cell PC-3 Cell Line
Recovery Medium F12K+10% FBS+1% P.S
Growth medium F12K+10% FBS+1% P.S+0.5 μg/mL Puromycin
Note None
Freezing Medium 90% FBS+10% DMSO
Growth properties Adherent
Growth Conditions 37°C, 5% CO₂
Safety considerations Biosafety Level 2
Mycoplasma Testing The cell line has been screened to confirm the absence of Mycoplasma species.
Cat. No GM-C35058
Product H_FOLH1(PSMA) PC-3 Cell Line
Description H_FOLH1(PSMA) PC-3 Cell Line is a clonal stable PC-3 cell line that constitutively expresses the human FOLH1(PSMA) gene, constructed using lentiviral technology.
Product Format 1 vial of frozen cells
Quantity 5E6 Cells per vial,1 mL
Storage Conditions Liquid nitrogen immediately upon receipt
Target H_FOLH1(PSMA)
Gene ID/Uniprot ID Q04609-1 1994-06-01 v1
Host Cell PC-3 Cell Line
Recovery Medium F12K+10% FBS+1% P.S
Growth medium F12K+10% FBS+1% P.S+0.5 μg/mL Puromycin
Note None
Freezing Medium 90% FBS+10% DMSO
Growth properties Adherent
Growth Conditions 37°C, 5% CO₂
Safety considerations Biosafety Level 2
Mycoplasma Testing The cell line has been screened to confirm the absence of Mycoplasma species.
Data Display
Expression
H_FOLH1(PSMA) PC-3 Cell Line (Cat. GM-C35058) was determined by flow cytometry using Anti-FOLH1(PSMA) hIgG1 Reference Antibody (Rosobio) (Cat. GM-87705MAB).
Assay Performance
Tumor growth curves of H_FOLH1(PSMA) PC-3 in BALB/c nude mice. H_FOLH1(PSMA) PC-3 cells (1×10^6 per mouse) were subcutaneously inoculated into BALB/c nude mice (male, 8 weeks old, n = 3). Tumor volume was measured twice per week and is presented as mean ± SEM.
Body weight changes after implantation of H_FOLH1(PSMA) PC-3 in BALB/c nude mice. Under the same conditions, body weight was measured twice per week and is presented as mean ± SEM.
Materials
Reagent Ordering Information
Puromycin Genomeditech/GM-040401
Pen/Strep Thermo/15140-122
Fetal Bovine Serum ExCell/FSP500
F12K BOSTER/PYG0036
Anti-FOLH1(PSMA) hIgG1 Reference Antibody  Genomeditech/GM-87705MAB
Reagent Ordering Information
Puromycin Genomeditech/GM-040401
Pen/Strep Thermo/15140-122
Fetal Bovine Serum ExCell/FSP500
F12K BOSTER/PYG0036
Anti-FOLH1(PSMA) hIgG1 Reference Antibody  Genomeditech/GM-87705MAB
Cell Culture

Cell Recovery

Recovery Medium: F12K+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 3E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: F12K+10% FBS+1% P.S+0.5 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Subculturing is necessary when the cell density reaches 90%. It is recommended to perform subculturing at a ratio of 1:3 to 1:4 every 2-3 days. Ensure that the density does not exceed 90%, as overcrowding can lead to reduced viability due to compression.

b)         Remove and discard culture medium.

c)          Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

d)         Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 2 to 3 minutes at 37°C).

e)          Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

f)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

g)         After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

h)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:3 - 1:4 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          It is normal to observe a number of dead cells immediately after thawing. The condition will improve significantly after adjustment. Once the cells stabilize, the number of dead cells will decrease after subculturing, and the cell growth rate will become stable.

b)         Ensure that the cell density does not exceed 90%, as overcrowding may lead to reduced viability due to compression.

c)          FBS should be heat-inactivated at 56°C for 30 minutes to inactivate complement and certain viruses, with minimal impact on most growth factor and cytokine activities.

Cell Recovery

Recovery Medium: F12K+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 3E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: F12K+10% FBS+1% P.S+0.5 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Subculturing is necessary when the cell density reaches 90%. It is recommended to perform subculturing at a ratio of 1:3 to 1:4 every 2-3 days. Ensure that the density does not exceed 90%, as overcrowding can lead to reduced viability due to compression.

b)         Remove and discard culture medium.

c)          Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

d)         Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 2 to 3 minutes at 37°C).

e)          Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

f)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

g)         After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

h)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:3 - 1:4 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          It is normal to observe a number of dead cells immediately after thawing. The condition will improve significantly after adjustment. Once the cells stabilize, the number of dead cells will decrease after subculturing, and the cell growth rate will become stable.

b)         Ensure that the cell density does not exceed 90%, as overcrowding may lead to reduced viability due to compression.

c)          FBS should be heat-inactivated at 56°C for 30 minutes to inactivate complement and certain viruses, with minimal impact on most growth factor and cytokine activities.

Sequence

PSMA Q04609-1
MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA

PSMA Q04609-1
MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA

Related products
FOLH1(PSMA)
Cynomolgus_FOLH1(PSMA) CHO-K1 Cell Line H_FOLH1(PSMA) CHO-K1 Cell Line H_FOLH1(PSMA) HEK-293 Cell Line
H_FOLH1(PSMA) RM-1 Cell Line
Anti-FOLH1(PSMA) hIgG1 Antibody Anti-FOLH1(PSMA) hIgG1 Reference Antibody 
Cynomolgus FOLH1(PSMA) Protein; His Tag    
ADC Related Product
Anti-DXD Mouse IgG1 Antibody  Anti-DXD Mouse IgG1 Antibody  Anti-Dxd Mouse IgG2a Antibody 
Anti-Eribulin Mouse IgG2a Antibody  Anti-MMAE Mouse IgG1 Antibody  Anti-MMAE Mouse IgG2a Antibody 
Anti-MMAE Mouse IgG2a Antibody  Anti-SN38 Mouse IgG1 Antibody Mouse anti Human IgG1-DXD
Mouse anti Human IgG1-MMAE Human IgG1 Isotype-DXD (Dar8) Human IgG1 Isotype-Eribulin (Dar4)
Human IgG1 Isotype-MMAE (Dar4)
Recombinant DT3C Protein    
KLK2 KLK3
Membrane bound H_KLK2(AA19-261) CHO-K1 Cell Line Membrane bound H_KLK2(AA19-261) HEK-293 Cell Line Membrane bound H_KLK2(AA19-261) LnCap Cell Line
Membrane bound H_KLK2(AA25-261) CHO-K1 Cell Line Membrane bound H_KLK2(AA25-261) CT26 Cell Line Membrane bound H_KLK2(AA25-261) HEK-293 Cell Line
Membrane bound H_KLK2(AA25-261) MC38 Cell Line (Low Expression)
Anti-KLK2 hIgG1 Antibody
Biotinylated Human KLK2 Protein; His-Avi Tag    
ACP3
Flag-H_ACP3 HCT116 Cell Line Flag-H_ACP3 HT-1080 Cell Line H_ACP3 HCT116 Cell Line
H_ACP3 HT-1080 Cell Line H_ACP3 PC-3 Cell Line  
Message consultation
reset
submit
Message
Message consultation
reset
submit