Current position:Product Center > Cell lines > TAA > TROP2 > Cynomolgus_TROP2 HEK-293 Cell Line
Cynomolgus_TROP2 HEK-293 Cell Line
Specifications
Cat. NoGM-C34141
ProductCynomolgus_TROP2 HEK-293 Cell Line
DescriptionCynomolgus_TROP2 HEK-293 Cell Line is a clonal stable HEK-293 cell line constitutively expressing cynomolgus TROP2.
Product Format1 vial of frozen cells
Quantity5E6 Cells per vial,1 mL
Storage ConditionsLiquid nitrogen immediately upon receipt
TargetCynomolgus_TROP2
Gene ID/Uniprot IDA0A2K5UE71
Host CellHEK-293
Recovery MediumDMEM+10% FBS+1% P.S
Growth mediumDMEM+10% FBS+1% P.S+0.75 μg/mL Puromycin
NoteNone
Freezing Medium90% FBS+10% DMSO
Growth propertiesAdherent
Growth Conditions37°C, 5% CO₂
Safety considerationsBiosafety Level 2
Mycoplasma TestingThe cell line has been screened to confirm the absence of Mycoplasma species.
Data
Cynomolgus_TROP2 HEK-293 Cell Line was determined by flow cytometry using AntiH_TROP2 hIgG1Antibody(Datopotamab) (Genomeditech/GM-26561AB).
Materials
ReagentOrdering Information
DMEMGibco/C11995500BT
Fetal Bovine SerumExCell/FSP500
Pen/StrepThermo/15140-122
PuromycinGenomeditech/GM-040401
Anti-H_TROP2 hIgG1 Antibody(Datopotamab)Genomeditech/GM-26561AB
Cell Culture

Cell Recovery

Recovery Medium: DMEM+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: DMEM+10% FBS+1% P.S+125 μg/mL Hygromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Subculturing is necessary when the cell density reaches 80%. It is recommended to perform subculturing at a ratio of 1:3 to 1:4 every 2-3 days. Ensure that the density does not exceed 80%, as overcrowding can lead to reduced viability due to compression.

b)         Remove and discard culture medium.

c)          Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

d)         Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 30 to 60 seconds at 37°C).

e)          Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

f)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

g)         After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

h)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:3 - 1:4 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          Upon initial thawing, a higher number of dead cells is observed, which is a normal phenomenon. Significant improvement is seen after adaptation. Once the cells reach a stable state, the number of dead cells decreases after subculturing and the cell growth rate becomes stable.

b)         Ensure that the cell density does not exceed 80%, as overcrowding may lead to reduced viability due to compression.

Sequence

TACSTD2(TROP2) A0A2K5UE71
MARGPGLAPPPLRLPLLLLLLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGVAVDCSTLTSECLLLKARMSAPKNARTLVRPNEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDVKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGVAVLVISNRRKSGKYKKVEIKELGELRKEPSLKHF*

Related Products
Get A Quote
CLDN18
Cynomolgus_CLDN18.2-eGFP CHO-K1 Cell LineH_CLDN18(isoform2)-eGFP 293 Cell LineH_CLDN18.1-eGFP HEK-293 Cell Line
H_CLDN18.2 MC38 Cell LineH_CLDN18.2 MKN45 Cell Line(High Expression)H_CLDN18.2 MKN45 Cell Line(Low Expression)
H_CLDN18.2 MKN45 Cell Line(Medium Expression)H_CLDN18.2(isoform2) CHO-K1 Cell LineH_CLDN18.2(isoform2) MKN45 Cell Line
H_CLDN18.2-eGFP CT-26 Cell LineMouse_CLDN18.2-eGFP CHO-K1 Cell LineRat_CLDN18.2-eGFP CHO-K1 Cell Line
Rhesus_CLDN18.2-eGFP CHO-K1 Cell Line

Anti-CLDN18.2  hIgG1 Reference Antibody (IMAB362)Anti-CLDN18.2 hIgG1 Antibody(LM-102)Anti-CLDN18.2 hIgG1 Antibody(Zolbetuximab)
HER3(ERBB3)
Cynomolgus_ERBB3(HER3) CHO-K1 Cell Line Cynomolgus_ERBB3(HER3) HEK-293 Cell Line H_ERBB3(HER3) CHO-K1 Cell Line
H_ERBB3(HER3) HEK-293 Cell LineH_ERBB3(HER3) MC38 Cell LineMouse_HER3(ERBB3) CHO-K1 Cell Line
Anti-ERBB3(HER3) hIgG1 Reference Antibody(Patribio)Anti-H_ERBB3(HER3) hIgG1 Antibody(Barecetamab)
Biotinylated Human HER3 Protein; His-Avi TagHuman HER3 Protein; His TagMouse HER3 Protein; His Tag
C-MET:HGF
H_cMET KO HEK-293 Cell LineH_cMET: cMET Dimerization U2OS Cell LineCynomolgus_cMET CHO-K1 Cell Line
H_cMET CHO-K1 Cell LineH_cMET HEK-293 Cell LineH_cMET HEK-293(cMET KO) Cell Line
Anti-H_HGFR(Met) hIgG4 Antibody(Emibetuzumab)

Human HGFR(Met) Protein; His Tag

CD276(B7H3)
Cynomolgus_CD276 CHO-K1 Cell LineH_CD276(B7H3) CHO-K1 Cell Line
Anti-CD276(B7H3) hIgG1 Reference Antibody(Ifibio)

Biotinylated Human CD276(B7H3 2Ig) Protein; His-Avi TagBiotinylated Human CD276(B7H3 4Ig) Protein; His-Avi TagHuman CD276(B7H3 2Ig) Protein; His Tag
Human CD276(B7H3 4Ig) Protein; His Tag

TROP2(TACSTD2)
Cynomolgus_Trop2 CHO-K1 Cell LineH_TROP2 CHO-K1 Cell LineH_TROP2 CT26 Cell Line
H_TROP2 HEK-293 Cell LineH_TROP2 LLC1 Cell LineH_TROP2 MC38 Cell Line
Anti-H_TROP2 hIgG1 Antibody(Datopotamab)Anti-TROP2 hIgG1 Antibody(Hu2G10-5)Anti-Trop2 hIgG1 Reference Antibody (Sacbio)
Anti-Trop2 hIgG1 Reference Antibody(Datbio)Anti-Trop2-DXD ADC(Dar4)[Datopotamab deruxtecan,Dato-DXD]Anti-Trop2-SN38 ADC(Dar8)[Sacituzumab govitecan]
Biotinylated Cynomolgus TROP2 Protein; His-Avi TagBiotinylated Human TROP2 Protein; His-Avi TagHuman TROP2 Protein; His Tag
GUCY2C(GC-C)
Cynomolgus_GUCY2C HEK-293 Cell LineH_GUCY2C CHO-K1 Cell LineH_GUCY2C HEK-293 Cell Line
Anti-H_GUCY2C hIgG1 Antibody(Indusatumab)

FGFR2
H_FGFR2b CHO-K1 Cell LineH_FGFR2b HEK-293 Cell LineMouse_FGFR2b HEK-293 Cell Line
Cynomolgus FGFR2(IIIb) D1-D3 Protein; His TagHuman FGFR2(IIIb) D1-D3 Protein; hFc TagHuman FGFR2(IIIb) D2-D3 Protein; hFc Tag
Human FGFR2(IIIb) D2-D3 Protein; His TagHuman FGFR2(IIIc) D1-D3 Protein; His TagMouse FGFR2(IIIb) D2-D3 Protein; His Tag
CD44-CD44v6
H_CD44v6 CHO-K1 Cell LineH_CD44v6 HEK-293 Cell Line
Anti-CD44v6 hIgG1 Antibody(bivatuzumab)

ADC Related Product
Anti-DXD Mouse IgG1 Antibody (23E21C5)Anti-DXD Mouse IgG1 Antibody (4A5A12)Anti-Dxd Mouse IgG2a Antibody (17D6A4)
Anti-Eribulin Mouse IgG2a Antibody (10F8G4)Anti-MMAE Mouse IgG1 Antibody (11C10E3)Anti-MMAE Mouse IgG2a Antibody (17A1K11)
Anti-MMAE Mouse IgG2a Antibody (8F6A3)Mouse anti Human IgG1-MMAE(Dar4)Human IgG1 Isotype-DXD (Dar8)
Human IgG1 Isotype-Eribulin (Dar4)Human IgG1 Isotype-MMAE (Dar4)
Recombinant DT3C Protein

Message Consultation
If you have more questions, please fill in the relevant information,we'll respond as soon as possible to assist you!
Reset
Submit
You can also contact us on the Scientist and Science Exchange marketplaces.
Current Position:Product Center > Cell lines > TAA > TROP2 > Cynomolgus_TROP2 HEK-293 Cell Line
classify
Cynomolgus_TROP2 HEK-293 Cell Line
Specifications
Cat. NoGM-C34141
ProductCynomolgus_TROP2 HEK-293 Cell Line
DescriptionCynomolgus_TROP2 HEK-293 Cell Line is a clonal stable HEK-293 cell line constitutively expressing cynomolgus TROP2.
Product Format1 vial of frozen cells
Quantity5E6 Cells per vial,1 mL
Storage ConditionsLiquid nitrogen immediately upon receipt
TargetCynomolgus_TROP2
Gene ID/Uniprot IDA0A2K5UE71
Host CellHEK-293
Recovery MediumDMEM+10% FBS+1% P.S
Growth mediumDMEM+10% FBS+1% P.S+0.75 μg/mL Puromycin
NoteNone
Freezing Medium90% FBS+10% DMSO
Growth propertiesAdherent
Growth Conditions37°C, 5% CO₂
Safety considerationsBiosafety Level 2
Mycoplasma TestingThe cell line has been screened to confirm the absence of Mycoplasma species.
Data
Cynomolgus_TROP2 HEK-293 Cell Line was determined by flow cytometry using AntiH_TROP2 hIgG1Antibody(Datopotamab) (Genomeditech/GM-26561AB).
Materials
ReagentOrdering Information
DMEMGibco/C11995500BT
Fetal Bovine SerumExCell/FSP500
Pen/StrepThermo/15140-122
PuromycinGenomeditech/GM-040401
Anti-H_TROP2 hIgG1 Antibody(Datopotamab)Genomeditech/GM-26561AB
Cell Culture

Cell Recovery

Recovery Medium: DMEM+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: DMEM+10% FBS+1% P.S+125 μg/mL Hygromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Subculturing is necessary when the cell density reaches 80%. It is recommended to perform subculturing at a ratio of 1:3 to 1:4 every 2-3 days. Ensure that the density does not exceed 80%, as overcrowding can lead to reduced viability due to compression.

b)         Remove and discard culture medium.

c)          Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

d)         Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 30 to 60 seconds at 37°C).

e)          Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

f)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

g)         After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

h)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:3 - 1:4 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          Upon initial thawing, a higher number of dead cells is observed, which is a normal phenomenon. Significant improvement is seen after adaptation. Once the cells reach a stable state, the number of dead cells decreases after subculturing and the cell growth rate becomes stable.

b)         Ensure that the cell density does not exceed 80%, as overcrowding may lead to reduced viability due to compression.

Sequence

TACSTD2(TROP2) A0A2K5UE71
MARGPGLAPPPLRLPLLLLLLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGVAVDCSTLTSECLLLKARMSAPKNARTLVRPNEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDVKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGVAVLVISNRRKSGKYKKVEIKELGELRKEPSLKHF*

Related Products
Get A Quote
CLDN18
Cynomolgus_CLDN18.2-eGFP CHO-K1 Cell LineH_CLDN18(isoform2)-eGFP 293 Cell LineH_CLDN18.1-eGFP HEK-293 Cell Line
H_CLDN18.2 MC38 Cell LineH_CLDN18.2 MKN45 Cell Line(High Expression)H_CLDN18.2 MKN45 Cell Line(Low Expression)
H_CLDN18.2 MKN45 Cell Line(Medium Expression)H_CLDN18.2(isoform2) CHO-K1 Cell LineH_CLDN18.2(isoform2) MKN45 Cell Line
H_CLDN18.2-eGFP CT-26 Cell LineMouse_CLDN18.2-eGFP CHO-K1 Cell LineRat_CLDN18.2-eGFP CHO-K1 Cell Line
Rhesus_CLDN18.2-eGFP CHO-K1 Cell Line

Anti-CLDN18.2  hIgG1 Reference Antibody (IMAB362)Anti-CLDN18.2 hIgG1 Antibody(LM-102)Anti-CLDN18.2 hIgG1 Antibody(Zolbetuximab)
HER3(ERBB3)
Cynomolgus_ERBB3(HER3) CHO-K1 Cell Line Cynomolgus_ERBB3(HER3) HEK-293 Cell Line H_ERBB3(HER3) CHO-K1 Cell Line
H_ERBB3(HER3) HEK-293 Cell LineH_ERBB3(HER3) MC38 Cell LineMouse_HER3(ERBB3) CHO-K1 Cell Line
Anti-ERBB3(HER3) hIgG1 Reference Antibody(Patribio)Anti-H_ERBB3(HER3) hIgG1 Antibody(Barecetamab)
Biotinylated Human HER3 Protein; His-Avi TagHuman HER3 Protein; His TagMouse HER3 Protein; His Tag
C-MET:HGF
H_cMET KO HEK-293 Cell LineH_cMET: cMET Dimerization U2OS Cell LineCynomolgus_cMET CHO-K1 Cell Line
H_cMET CHO-K1 Cell LineH_cMET HEK-293 Cell LineH_cMET HEK-293(cMET KO) Cell Line
Anti-H_HGFR(Met) hIgG4 Antibody(Emibetuzumab)

Human HGFR(Met) Protein; His Tag

CD276(B7H3)
Cynomolgus_CD276 CHO-K1 Cell LineH_CD276(B7H3) CHO-K1 Cell Line
Anti-CD276(B7H3) hIgG1 Reference Antibody(Ifibio)

Biotinylated Human CD276(B7H3 2Ig) Protein; His-Avi TagBiotinylated Human CD276(B7H3 4Ig) Protein; His-Avi TagHuman CD276(B7H3 2Ig) Protein; His Tag
Human CD276(B7H3 4Ig) Protein; His Tag

TROP2(TACSTD2)
Cynomolgus_Trop2 CHO-K1 Cell LineH_TROP2 CHO-K1 Cell LineH_TROP2 CT26 Cell Line
H_TROP2 HEK-293 Cell LineH_TROP2 LLC1 Cell LineH_TROP2 MC38 Cell Line
Anti-H_TROP2 hIgG1 Antibody(Datopotamab)Anti-TROP2 hIgG1 Antibody(Hu2G10-5)Anti-Trop2 hIgG1 Reference Antibody (Sacbio)
Anti-Trop2 hIgG1 Reference Antibody(Datbio)Anti-Trop2-DXD ADC(Dar4)[Datopotamab deruxtecan,Dato-DXD]Anti-Trop2-SN38 ADC(Dar8)[Sacituzumab govitecan]
Biotinylated Cynomolgus TROP2 Protein; His-Avi TagBiotinylated Human TROP2 Protein; His-Avi TagHuman TROP2 Protein; His Tag
GUCY2C(GC-C)
Cynomolgus_GUCY2C HEK-293 Cell LineH_GUCY2C CHO-K1 Cell LineH_GUCY2C HEK-293 Cell Line
Anti-H_GUCY2C hIgG1 Antibody(Indusatumab)

FGFR2
H_FGFR2b CHO-K1 Cell LineH_FGFR2b HEK-293 Cell LineMouse_FGFR2b HEK-293 Cell Line
Cynomolgus FGFR2(IIIb) D1-D3 Protein; His TagHuman FGFR2(IIIb) D1-D3 Protein; hFc TagHuman FGFR2(IIIb) D2-D3 Protein; hFc Tag
Human FGFR2(IIIb) D2-D3 Protein; His TagHuman FGFR2(IIIc) D1-D3 Protein; His TagMouse FGFR2(IIIb) D2-D3 Protein; His Tag
CD44-CD44v6
H_CD44v6 CHO-K1 Cell LineH_CD44v6 HEK-293 Cell Line
Anti-CD44v6 hIgG1 Antibody(bivatuzumab)

ADC Related Product
Anti-DXD Mouse IgG1 Antibody (23E21C5)Anti-DXD Mouse IgG1 Antibody (4A5A12)Anti-Dxd Mouse IgG2a Antibody (17D6A4)
Anti-Eribulin Mouse IgG2a Antibody (10F8G4)Anti-MMAE Mouse IgG1 Antibody (11C10E3)Anti-MMAE Mouse IgG2a Antibody (17A1K11)
Anti-MMAE Mouse IgG2a Antibody (8F6A3)Mouse anti Human IgG1-MMAE(Dar4)Human IgG1 Isotype-DXD (Dar8)
Human IgG1 Isotype-Eribulin (Dar4)Human IgG1 Isotype-MMAE (Dar4)
Recombinant DT3C Protein

Message Consultation
If you have more questions, please fill in the relevant information,we'll respond as soon as possible to assist you!
Reset
Submit
You can also contact us on the Scientist and Science Exchange marketplaces.
Message consultation
reset
submit
Message
Message consultation
reset
submit