Current position:Product Center > Cell lines > TAA > SLC39A6 > Cynomolgus_SLC39A6 CHO-K1 Cell Line
Cynomolgus_SLC39A6 CHO-K1 Cell Line
Product Info

Cat. No:GM-C15382

Product:Cynomolgus_SLC39A6 CHO-K1 Cell Line

Materials required

Cell Growth Medium:F12K+10% FBS+1% P.S+4 μg/mL Puromycin

Cell Freezing Medium:90% FBS+10% DMSO


Description

Cynomolgus_SLC39A6 amino acid sequence :

MARKLSVILILTFTLSVTNPLHELKSAAAFPQTTEKISPNWESGINVDLAITTRQYHLQQLFYRYGENNSLSVEGFRKLLQNIGIDKIKRIHIHHDHDHHSDHEHHSDHEHHSDHEHHSHRNHAASGKNKRKALCPEHDSDSSGKDPRNSQGKGAHRPEHANGRRNVKDSVSTSEVTSTVYNTVSEGTHFLETIETPKLFPKDVSSSTPPSVTEKSLVSRLAGRKTNESMSEPRKGFMYSRNTNENPQECFNASKLLTSHGMGIQVPLNATEFNYLCPAIINQIDARSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMNRVFFKFLLSFLVALAVGTLSGDAFLHLLPHSHASHHHSHSHEEPAMEMKRGPLFSHLSSQNIEESAYFDSTWKGLTALGGLYFMFLVEHVLTLIKQFKDKKKKNQKKPENDDDVEIKKQLSKYESQLSTNEEKVDTDDRTEGYLRADSQEPSHFDSQQPAILEEEEVMIAHAHPQEVYNEYVPRGCKNKCHSHFHDTLGQSDDLIHHHHDYHHILHHHHHQNHHPHSHSQRYSREELKDAGIATLAWMVIMGDGLHNFSDGLAIGAAFTEGLSSGLSTSVAVFCHELPHELGDFAVLLKAGMTVKQAVLYNALSAMLAYLGMATGIFIGHYAENVSMWIFALTAGLFMYVALVDMVPEMLHNDASDHGCSRWGYFFLQNAGMLLGFGIMLLISIFEHKIVFRINF


Data
Related Products
Get A Quote
HER3(ERBB3)
Cynomolgus_ERBB3(HER3) CHO-K1 Cell Line Cynomolgus_ERBB3(HER3) HEK-293 Cell Line H_ERBB3(HER3) CHO-K1 Cell Line
H_ERBB3(HER3) HEK-293 Cell LineH_ERBB3(HER3) MC38 Cell LineMouse_HER3(ERBB3) CHO-K1 Cell Line
Anti-ERBB3(HER3) hIgG1 Reference Antibody(Patribio)Anti-H_ERBB3(HER3) hIgG1 Antibody(Barecetamab)Anti-H_HER3 hIgG1 Antibody(Patritumab)
Human HER3 Protein; His Tag

NECTIN4
Cynomolgus_Nectin4 CHO-K1 Cell LineH_NECTIN4 CT26 Cell LineH_NECTIN4 HEK-293 Cell Line
H_NECTIN4 LLC1 Cell LineH_NECTIN4 MC38 Cell LineH_NECTIN4(nectin-4) CHO-K1 Cell Line
Mouse_NECTIN4 CHO-K1 Cell Line

Anti-H_Nectin4 hIgG1 Antibody(Enfortumab)Anti-Nectin4 hIgG1 Reference Antibody (Enfobio)
Biotinylated Cynomolgus Nectin-4 Protein; His-Avi TagBiotinylated Human Nectin-4 Protein; His-Avi TagBiotinylated Mouse Nectin-4 Protein; His-Avi Tag
Cynomolgus Nectin-4 Protein; His TagHuman Nectin-4 Protein; His Tag
SLC39A6(LIV1)
H_SLC39A6 CHO-K1 Cell LineH_SLC39A6 HEK-293 Cell LineH_SLC39A6 LLC1 Cell Line
H_SLC39A6 MC38 Cell Line

Anti-H_SLC39A6 hIgG1 Antibody(Ladiratuzumab)Anti-SLC39A6 hIgG1 Reference Antibody (Ladbio)
Anti-SLC39A6-MMAE ADC(Dar4)[Ladiratuzumab vedotin]

HER2(ERBB2)
H_HER2 HER4 Reporter HEK-293 Cell LineCynomolgus_HER2(ERBB2) CHO-K1 Cell LineH_HER2 EMT6 Cell Line
H_HER2 HER3 MC38 Cell LineH_HER2 MCF-7 Cell LineH_HER2(ERBB2) CHO-K1 Cell Line
H_HER2(ERBB2) CT26 Cell LineH_HER2(ERBB2) LLC1 Cell LineH_HER2(ERBB2) MC38 Cell Line
Anti-H_HER2 hIgG1 Antibody(Margetuximab)Anti-HER2 hIgG1 Reference Antibody(Marbio)Anti-HER2 hIgG1 Reference Antibody(Trasbio)
Anti-HER2-DM1 ADC(Dar4)[Trastuzumab emtansine,T-DM1]Anti-HER2-DXD ADC(Dar8)[Trastuzumab Deruxtecan]
Cynomolgus HER2 Protein; His TagHuman HER2 Protein; His Tag
ADC Related Product
Anti-DXD Mouse IgG1 Antibody (23E21C5)Anti-DXD Mouse IgG1 Antibody (4A5A12)Anti-Dxd Mouse IgG2a Antibody (17D6A4)
Anti-Eribulin Mouse IgG2a Antibody (10F8G4)Anti-MMAE Mouse IgG1 Antibody (11C10E3)Anti-MMAE Mouse IgG2a Antibody (17A1K11)
Anti-MMAE Mouse IgG2a Antibody (8F6A3)Mouse anti Human IgG-MMAE(Dar4)
Human IgG1 Isotype-DXD (Dar8)Human IgG1 Isotype-Eribulin (Dar4)Human IgG1 Isotype-MMAE (Dar4)
Recombinant DT3C Protein


Message Consultation
If you have more questions, please fill in the relevant information,we'll respond as soon as possible to assist you!
Reset
Submit
You can also contact us on the Scientist and Science Exchange marketplaces.
Current Position:Product Center > Cell lines > TAA > SLC39A6 > Cynomolgus_SLC39A6 CHO-K1 Cell Line
classify
Cynomolgus_SLC39A6 CHO-K1 Cell Line
Product Info

Cat. No:GM-C15382

Product:Cynomolgus_SLC39A6 CHO-K1 Cell Line

Materials required

Cell Growth Medium:F12K+10% FBS+1% P.S+4 μg/mL Puromycin

Cell Freezing Medium:90% FBS+10% DMSO


Description

Cynomolgus_SLC39A6 amino acid sequence :

MARKLSVILILTFTLSVTNPLHELKSAAAFPQTTEKISPNWESGINVDLAITTRQYHLQQLFYRYGENNSLSVEGFRKLLQNIGIDKIKRIHIHHDHDHHSDHEHHSDHEHHSDHEHHSHRNHAASGKNKRKALCPEHDSDSSGKDPRNSQGKGAHRPEHANGRRNVKDSVSTSEVTSTVYNTVSEGTHFLETIETPKLFPKDVSSSTPPSVTEKSLVSRLAGRKTNESMSEPRKGFMYSRNTNENPQECFNASKLLTSHGMGIQVPLNATEFNYLCPAIINQIDARSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMNRVFFKFLLSFLVALAVGTLSGDAFLHLLPHSHASHHHSHSHEEPAMEMKRGPLFSHLSSQNIEESAYFDSTWKGLTALGGLYFMFLVEHVLTLIKQFKDKKKKNQKKPENDDDVEIKKQLSKYESQLSTNEEKVDTDDRTEGYLRADSQEPSHFDSQQPAILEEEEVMIAHAHPQEVYNEYVPRGCKNKCHSHFHDTLGQSDDLIHHHHDYHHILHHHHHQNHHPHSHSQRYSREELKDAGIATLAWMVIMGDGLHNFSDGLAIGAAFTEGLSSGLSTSVAVFCHELPHELGDFAVLLKAGMTVKQAVLYNALSAMLAYLGMATGIFIGHYAENVSMWIFALTAGLFMYVALVDMVPEMLHNDASDHGCSRWGYFFLQNAGMLLGFGIMLLISIFEHKIVFRINF


Data
Related Products
Get A Quote
HER3(ERBB3)
Cynomolgus_ERBB3(HER3) CHO-K1 Cell Line Cynomolgus_ERBB3(HER3) HEK-293 Cell Line H_ERBB3(HER3) CHO-K1 Cell Line
H_ERBB3(HER3) HEK-293 Cell LineH_ERBB3(HER3) MC38 Cell LineMouse_HER3(ERBB3) CHO-K1 Cell Line
Anti-ERBB3(HER3) hIgG1 Reference Antibody(Patribio)Anti-H_ERBB3(HER3) hIgG1 Antibody(Barecetamab)Anti-H_HER3 hIgG1 Antibody(Patritumab)
Human HER3 Protein; His Tag

NECTIN4
Cynomolgus_Nectin4 CHO-K1 Cell LineH_NECTIN4 CT26 Cell LineH_NECTIN4 HEK-293 Cell Line
H_NECTIN4 LLC1 Cell LineH_NECTIN4 MC38 Cell LineH_NECTIN4(nectin-4) CHO-K1 Cell Line
Mouse_NECTIN4 CHO-K1 Cell Line

Anti-H_Nectin4 hIgG1 Antibody(Enfortumab)Anti-Nectin4 hIgG1 Reference Antibody (Enfobio)
Biotinylated Cynomolgus Nectin-4 Protein; His-Avi TagBiotinylated Human Nectin-4 Protein; His-Avi TagBiotinylated Mouse Nectin-4 Protein; His-Avi Tag
Cynomolgus Nectin-4 Protein; His TagHuman Nectin-4 Protein; His Tag
SLC39A6(LIV1)
H_SLC39A6 CHO-K1 Cell LineH_SLC39A6 HEK-293 Cell LineH_SLC39A6 LLC1 Cell Line
H_SLC39A6 MC38 Cell Line

Anti-H_SLC39A6 hIgG1 Antibody(Ladiratuzumab)Anti-SLC39A6 hIgG1 Reference Antibody (Ladbio)
Anti-SLC39A6-MMAE ADC(Dar4)[Ladiratuzumab vedotin]

HER2(ERBB2)
H_HER2 HER4 Reporter HEK-293 Cell LineCynomolgus_HER2(ERBB2) CHO-K1 Cell LineH_HER2 EMT6 Cell Line
H_HER2 HER3 MC38 Cell LineH_HER2 MCF-7 Cell LineH_HER2(ERBB2) CHO-K1 Cell Line
H_HER2(ERBB2) CT26 Cell LineH_HER2(ERBB2) LLC1 Cell LineH_HER2(ERBB2) MC38 Cell Line
Anti-H_HER2 hIgG1 Antibody(Margetuximab)Anti-HER2 hIgG1 Reference Antibody(Marbio)Anti-HER2 hIgG1 Reference Antibody(Trasbio)
Anti-HER2-DM1 ADC(Dar4)[Trastuzumab emtansine,T-DM1]Anti-HER2-DXD ADC(Dar8)[Trastuzumab Deruxtecan]
Cynomolgus HER2 Protein; His TagHuman HER2 Protein; His Tag
ADC Related Product
Anti-DXD Mouse IgG1 Antibody (23E21C5)Anti-DXD Mouse IgG1 Antibody (4A5A12)Anti-Dxd Mouse IgG2a Antibody (17D6A4)
Anti-Eribulin Mouse IgG2a Antibody (10F8G4)Anti-MMAE Mouse IgG1 Antibody (11C10E3)Anti-MMAE Mouse IgG2a Antibody (17A1K11)
Anti-MMAE Mouse IgG2a Antibody (8F6A3)Mouse anti Human IgG-MMAE(Dar4)
Human IgG1 Isotype-DXD (Dar8)Human IgG1 Isotype-Eribulin (Dar4)Human IgG1 Isotype-MMAE (Dar4)
Recombinant DT3C Protein


Message Consultation
If you have more questions, please fill in the relevant information,we'll respond as soon as possible to assist you!
Reset
Submit
You can also contact us on the Scientist and Science Exchange marketplaces.
Message consultation
reset
submit
Message
Message consultation
reset
submit