Where Discovery Begins
Membrane bound H_IL-23 CHO-K1 Cell Line
Cat. No.
GM-C40167
Size
2 vial
Quote
Specifications
Data display
Materials
Cell Culture
Related products
Sequence
Specifications
Cat. NoGM-C40167
ProductMembrane bound H_IL-23 CHO-K1 Cell Line
DescriptionMembrane bound H_IL-23 CHO-K1 Cell Line is a clonal stable CHO-K1 cell line that constitutively expresses the human IL12B(p40) and Human IL23A(p19) genes, constructed using lentiviral technology.
Product Format1 vial of frozen cells
Quantity5E6 Cells per vial,1 mL
Storage ConditionsLiquid nitrogen immediately upon receipt
TargetHuman IL12B(p40) & Human IL23A(p19)
Gene ID/Uniprot IDP29460 & Q9NPF7
Host CellCHO-K1
Recovery MediumF12K+10% FBS+1% P.S
Growth mediumF12K+10% FBS+1% P.S+4 μg/mL Puromycin
NoteNone
Freezing Medium90% FBS+10% DMSO
Growth propertiesAdherent
Growth Conditions37°C, 5% CO₂
Safety considerationsBiosafety Level 2
Mycoplasma TestingThe cell line has been screened to confirm the absence of Mycoplasma species.
Data display
Membrane bound H_IL-23 CHO-K1 Cell Line (Cat. GM-C40167) was determined by flow cytometry using IL-23 p19 Monoclonal Antibody (23dcdp) (ThermoFishe/12-7823-41).
Membrane bound H_IL-23 CHO-K1 Cell Line (Cat. GM-C40167) was determined by flow cytometry using IL12B Rabbit mAb (23dcdp) (Abclonal/A24262).
Response to Membrane bound H_IL-23 CHO-K1 Cell Line. H_IL-23 Reporter 293 Cell Line (Cat. GM-C06722) at a concentration of 1.5E4 cells/well (96-well format) was stimulated with serial dilutions of Membrane bound H_IL-23 CHO-K1 Cell Line (Cat. GM-C40167) for 6 hours. The firefly luciferase activity was measured using the GMOne-Step 2.0 Luciferase Reporter Gene Assay Kit (Cat. GM-040513).
Materials
ReagentOrdering Information
F12KBOSTER/PYG0036
Fetal Bovine SerumExCell/FSP500
Pen/StrepThermo/15140-122
PuromycinGenomeditech/GM-040401
IL-23 p19 Monoclonal Antibody (23dcdp), PEThermoFishe/12-7823-41
IL12B Rabbit mAbAbclonal/A24262
GMOne-Step 2.0 Luciferase Reporter Gene Assay KitGenomeditech/GM-040513
Cell Culture

Cell Recovery

Recovery Medium: F12K+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: F12K+10% FBS+1% P.S+4 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Remove and discard culture medium.

b)         Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

c)          Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 2 to 3 minutes at 37°C).

d)         Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

e)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

f)          After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

g)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:4 - 1:5 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          After the stabilization of the cell condition, there will be fewer dead cells post-passage, the cell growth rate will tend to stabilize, cell morphology will become uniform, and the cells will appear robust.


Related products
IL-23
H_IL-23 Reporter 293 Cell Line Cynomolgus_IL-23R HEK-293 Cell Line H_IL-23R HEK-293 Cell Line
Anti-IL-23R hIgG1 Antibody(5D4)    
Biotinylated Human IL-23A&IL-12B Heterodimer Protein; His-Avi Tag Cynomolgus IL-23A & Human IL-12B Heterodimer Protein; His Tag Cynomolgus IL-23A & Mouse IL-12B Heterodimer Protein; His Tag
Human IL-23A&IL-12B Heterodimer Protein; His Tag Human IL-23R Protein; hFc Tag Mouse IL-23A&IL-12B Heterodimer Protein; His Tag
TNF:TNFR2:TNFR1
H_TNFR2 Null Reporter Cell Line H_TNFR2 Reporter Jurkat Cell Line H_TNFR2 Reporter V2 Cell Line
Cynomolgus_TNFRSF1B(TNFR2) CHO-K1 Cell Line H_TNFRSF1B(TNFR2) CHO-K1 Cell Line H_TNFRSF1B(TNFR2) HEK-293 Cell Line
Membrane Bound H_TNFα CHO-K1 Cell Line Membrane Bound H_TNFα(cleavage-resistant) CHO-K1 Cell Line  
Anti-H_TNFR2 hIgG1 Antibody(1H10) Anti-H_TNFRSF1B(TNFR2) hIgG1 Antibody(UC2.3.8) Anti-TNFR1 hIgG1 Antibody
Anti-TNF-α hIgG1 Antibody(CT-P17)    
TL1A:DR3(TNFRSF25)
H_TNFRSF25(DR3) Reporter Jurkat Cell Line H_TNFSF15(TL1A) Reporter Cell Line Mouse_TNFRSF25(DR3) Reporter Jurkat Cell Line
Cynomolgus_TNFSF15(TL1A) HEK-293 Cell Line H_TNFRSF25(DR3) CHO-K1 Cell Line H_TNFRSF25(DR3) HEK-293 Cell Line
H_TNFSF15(TL1A) CHO-K1 Cell Line H_TNFSF15(TL1A) HEK-293 Cell Line Mouse_TNFSF15(TL1A) HEK-293 Cell Line
Anti-H_TNFSF15(TL1A) hIgG1 Antibody(PF-06480605) Anti-H_TNFSF15(TL1A) hIgG1 Antibody(Tulisokibart、PRA-023) Anti-H_TNFSF15(TL1A) hIgG4 Antibody
Anti-TL1A hIgG1 Reference Antibody  Anti-TL1A hIgG1 Reference Antibody  Anti-TNFRSF25(DR3) hIgG1 Antibody(PTX-35)
Biotinylated Cynomolgus TL1A Protein; His-Avi Tag Biotinylated Human TL1A Protein; His-Avi Tag Cynomolgus TL1A Protein; His Tag
Human TL1A Protein; His Tag    
 
Sequence

IL12B(p40)&IL23A(p19)
MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS-RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.
Membrane bound H_IL-23 CHO-K1 Cell Line
Cat. No.
GM-C40167
Size
2 vial
Quote
Specifications
Data display
Materials
Cell Culture
Related products
Sequence
Specifications
Cat. NoGM-C40167
ProductMembrane bound H_IL-23 CHO-K1 Cell Line
DescriptionMembrane bound H_IL-23 CHO-K1 Cell Line is a clonal stable CHO-K1 cell line that constitutively expresses the human IL12B(p40) and Human IL23A(p19) genes, constructed using lentiviral technology.
Product Format1 vial of frozen cells
Quantity5E6 Cells per vial,1 mL
Storage ConditionsLiquid nitrogen immediately upon receipt
TargetHuman IL12B(p40) & Human IL23A(p19)
Gene ID/Uniprot IDP29460 & Q9NPF7
Host CellCHO-K1
Recovery MediumF12K+10% FBS+1% P.S
Growth mediumF12K+10% FBS+1% P.S+4 μg/mL Puromycin
NoteNone
Freezing Medium90% FBS+10% DMSO
Growth propertiesAdherent
Growth Conditions37°C, 5% CO₂
Safety considerationsBiosafety Level 2
Mycoplasma TestingThe cell line has been screened to confirm the absence of Mycoplasma species.
Cat. NoGM-C40167
ProductMembrane bound H_IL-23 CHO-K1 Cell Line
DescriptionMembrane bound H_IL-23 CHO-K1 Cell Line is a clonal stable CHO-K1 cell line that constitutively expresses the human IL12B(p40) and Human IL23A(p19) genes, constructed using lentiviral technology.
Product Format1 vial of frozen cells
Quantity5E6 Cells per vial,1 mL
Storage ConditionsLiquid nitrogen immediately upon receipt
TargetHuman IL12B(p40) & Human IL23A(p19)
Gene ID/Uniprot IDP29460 & Q9NPF7
Host CellCHO-K1
Recovery MediumF12K+10% FBS+1% P.S
Growth mediumF12K+10% FBS+1% P.S+4 μg/mL Puromycin
NoteNone
Freezing Medium90% FBS+10% DMSO
Growth propertiesAdherent
Growth Conditions37°C, 5% CO₂
Safety considerationsBiosafety Level 2
Mycoplasma TestingThe cell line has been screened to confirm the absence of Mycoplasma species.
Data display
Membrane bound H_IL-23 CHO-K1 Cell Line (Cat. GM-C40167) was determined by flow cytometry using IL-23 p19 Monoclonal Antibody (23dcdp) (ThermoFishe/12-7823-41).
Membrane bound H_IL-23 CHO-K1 Cell Line (Cat. GM-C40167) was determined by flow cytometry using IL12B Rabbit mAb (23dcdp) (Abclonal/A24262).
Response to Membrane bound H_IL-23 CHO-K1 Cell Line. H_IL-23 Reporter 293 Cell Line (Cat. GM-C06722) at a concentration of 1.5E4 cells/well (96-well format) was stimulated with serial dilutions of Membrane bound H_IL-23 CHO-K1 Cell Line (Cat. GM-C40167) for 6 hours. The firefly luciferase activity was measured using the GMOne-Step 2.0 Luciferase Reporter Gene Assay Kit (Cat. GM-040513).
Materials
ReagentOrdering Information
F12KBOSTER/PYG0036
Fetal Bovine SerumExCell/FSP500
Pen/StrepThermo/15140-122
PuromycinGenomeditech/GM-040401
IL-23 p19 Monoclonal Antibody (23dcdp), PEThermoFishe/12-7823-41
IL12B Rabbit mAbAbclonal/A24262
GMOne-Step 2.0 Luciferase Reporter Gene Assay KitGenomeditech/GM-040513
ReagentOrdering Information
F12KBOSTER/PYG0036
Fetal Bovine SerumExCell/FSP500
Pen/StrepThermo/15140-122
PuromycinGenomeditech/GM-040401
IL-23 p19 Monoclonal Antibody (23dcdp), PEThermoFishe/12-7823-41
IL12B Rabbit mAbAbclonal/A24262
GMOne-Step 2.0 Luciferase Reporter Gene Assay KitGenomeditech/GM-040513
Cell Culture

Cell Recovery

Recovery Medium: F12K+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: F12K+10% FBS+1% P.S+4 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Remove and discard culture medium.

b)         Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

c)          Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 2 to 3 minutes at 37°C).

d)         Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

e)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

f)          After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

g)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:4 - 1:5 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          After the stabilization of the cell condition, there will be fewer dead cells post-passage, the cell growth rate will tend to stabilize, cell morphology will become uniform, and the cells will appear robust.


Cell Recovery

Recovery Medium: F12K+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: F12K+10% FBS+1% P.S+4 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Remove and discard culture medium.

b)         Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

c)          Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 2 to 3 minutes at 37°C).

d)         Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

e)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

f)          After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

g)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:4 - 1:5 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          After the stabilization of the cell condition, there will be fewer dead cells post-passage, the cell growth rate will tend to stabilize, cell morphology will become uniform, and the cells will appear robust.


Related products
IL-23
H_IL-23 Reporter 293 Cell Line Cynomolgus_IL-23R HEK-293 Cell Line H_IL-23R HEK-293 Cell Line
Anti-IL-23R hIgG1 Antibody(5D4)    
Biotinylated Human IL-23A&IL-12B Heterodimer Protein; His-Avi Tag Cynomolgus IL-23A & Human IL-12B Heterodimer Protein; His Tag Cynomolgus IL-23A & Mouse IL-12B Heterodimer Protein; His Tag
Human IL-23A&IL-12B Heterodimer Protein; His Tag Human IL-23R Protein; hFc Tag Mouse IL-23A&IL-12B Heterodimer Protein; His Tag
TNF:TNFR2:TNFR1
H_TNFR2 Null Reporter Cell Line H_TNFR2 Reporter Jurkat Cell Line H_TNFR2 Reporter V2 Cell Line
Cynomolgus_TNFRSF1B(TNFR2) CHO-K1 Cell Line H_TNFRSF1B(TNFR2) CHO-K1 Cell Line H_TNFRSF1B(TNFR2) HEK-293 Cell Line
Membrane Bound H_TNFα CHO-K1 Cell Line Membrane Bound H_TNFα(cleavage-resistant) CHO-K1 Cell Line  
Anti-H_TNFR2 hIgG1 Antibody(1H10) Anti-H_TNFRSF1B(TNFR2) hIgG1 Antibody(UC2.3.8) Anti-TNFR1 hIgG1 Antibody
Anti-TNF-α hIgG1 Antibody(CT-P17)    
TL1A:DR3(TNFRSF25)
H_TNFRSF25(DR3) Reporter Jurkat Cell Line H_TNFSF15(TL1A) Reporter Cell Line Mouse_TNFRSF25(DR3) Reporter Jurkat Cell Line
Cynomolgus_TNFSF15(TL1A) HEK-293 Cell Line H_TNFRSF25(DR3) CHO-K1 Cell Line H_TNFRSF25(DR3) HEK-293 Cell Line
H_TNFSF15(TL1A) CHO-K1 Cell Line H_TNFSF15(TL1A) HEK-293 Cell Line Mouse_TNFSF15(TL1A) HEK-293 Cell Line
Anti-H_TNFSF15(TL1A) hIgG1 Antibody(PF-06480605) Anti-H_TNFSF15(TL1A) hIgG1 Antibody(Tulisokibart、PRA-023) Anti-H_TNFSF15(TL1A) hIgG4 Antibody
Anti-TL1A hIgG1 Reference Antibody  Anti-TL1A hIgG1 Reference Antibody  Anti-TNFRSF25(DR3) hIgG1 Antibody(PTX-35)
Biotinylated Cynomolgus TL1A Protein; His-Avi Tag Biotinylated Human TL1A Protein; His-Avi Tag Cynomolgus TL1A Protein; His Tag
Human TL1A Protein; His Tag    
 
Sequence

IL12B(p40)&IL23A(p19)
MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS-RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

IL12B(p40)&IL23A(p19)
MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS-RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

Contact
Us
Message Inquiry
reset
submit
Message
Message Inquiry
reset
submit