Current Position: Product Center
Mouse_OX40L CHO-K1 Cell Line
Cat. No.
GM-C36301
Size
1 Tube
Quote
Specifications
Data Display
Materials
Cell Culture
Sequence
Related products
Specifications
Cat. No GM-C36301
Product Mouse_OX40L CHO-K1 Cell Line
Description Mouse_OX40L CHO-K1 Cell Line is a clonal stable CHO-K1 cell line that constitutively expresses the mouse OX40L gene, constructed using lentiviral technology.
Product Format 1 vial of frozen cells
Quantity 5E6 Cells per vial,1 mL
Storage Conditions Liquid nitrogen immediately upon receipt
Target Mouse_OX40L
Gene ID/Uniprot ID P43488
Host Cell CHO-K1
Recovery Medium F12K+10% FBS+1% P.S
Growth medium F12K+10% FBS+1% P.S+4 μg/mL Puromycin
Note None
Freezing Medium 90% FBS+10% DMSO
Growth properties Adherent
Growth Conditions 37°C, 5% CO₂
Safety considerations Biosafety Level 2
Mycoplasma Testing The cell line has been screened to confirm the absence of Mycoplasma species.
Data Display
Expression
Mouse_OX40L CHO-K1 Cell Line (Cat. GM-C36301) was determined by flow cytometry using APC anti-mouse CD252 (OX40L) Antibody (biolegend/108811).
Materials
Reagent Ordering Information
F12K BOSTER/PYG0036
Fetal Bovine Serum ExCell/FSP500
Pen/Strep Thermo/15140-122
Puromycin Genomeditech/GM-040401
APC anti-mouse CD252 (OX40L) Antibody biolegend/108811
Cell Culture

Cell Recovery

Recovery Medium: F12K+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: F12K+10% FBS+1% P.S+4 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Remove and discard culture medium.

b)         Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

c)          Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 2 to 3 minutes at 37°C).

d)         Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

e)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

f)          After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

g)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:4 - 1:5 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          After the stabilization of the cell condition, there will be fewer dead cells post-passage, the cell growth rate will tend to stabilize, cell morphology will become uniform, and the cells will appear robust.

Sequence

OX40L P43488 1995-11-01 v1
MEGEGVQPLDENLENGSRPRFKWKKTLRLVVSGIKGAGMLLCFIYVCLQLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL

Related products
OX40:OX40L
H_OX40 Reporter Cell Line H_OX40 Reporter DDX35TM Cell Line Cynomolgus_OX40L CHO-K1 Cell Line
H_OX40 CHO-K1 Cell Line H_OX40L CHO-K1 Cell Line H_OX40L HEK-293 Cell Line
Anti-H_OX40 hIgG2 Antibody(Ivuxolimab) Anti-OX40L hIgG1 Reference Antibody(Oxebio) Anti-OX40L hIgG4 Antibody(Amlitelimab)
Anti-OX40L hIgG4 Reference Antibody(Amlbio)
Biotinylated Human OX40L Protein; His-Avi Tag Cynomolgus OX40 Protein; His Tag Cynomolgus OX40L Protein; His Tag
Cynomolgus OX40L Protein; mFc Tag Human OX40 Protein; His Tag Human OX40L Protein; His Tag
Human OX40L Protein; mFc Tag    
IL-4/IL-13
IL-4 Reporter Cell Line IL-4/IL-13 Reporter 293 Cell Line IL-4/IL-13 Reporter 293 DDX35TM Cell Line
Cynomolgus_IL4R CHO-K1 Cell Line H_IL4R CHO-K1 Cell Line H_IL4R CHO-K1 Cell Line (Low Expression)
H_IL4R HEK-293 Cell Line Mouse_IL4R CHO-K1 Cell Line
Anti-IL13 hIgG4 Reference Antibody (Lebribio) Anti-IL-4R hIgG1 Antibody(12B5) Anti-IL4R hIgG4 Antibody(Dupilumab)
Anti-IL4R hIgG4 Reference Antibody (Dupbio) Anti-IL-4R×IL31 hIgG4 Reference Antibody (PRO2198) Anti-Mouse IL-4RA mIgG1 Antibody
Biotinylated Human IL-4R alpha Protein; Avi-His Tag Cynomolgus IL-13 Protein; His Tag Cynomolgus IL-4R alpha Protein; His Tag
Human IL-13 Protein; His Tag Human IL-13RA1 Protein; His Tag Human IL-4 Protein; His Tag
Human IL-4R alpha Protein; hFc Tag Human IL-4R alpha Protein; His Tag Human IL-4R alpha Protein; mFc Tag
Mouse IL-13 Protein; His Tag Mouse IL-4R alpha Protein; His Tag Rat IL-4R alpha Protein; His Tag
IL-31
Cynomolgus_IL-31RA OSMR Reporter Baf3 Cell Line H_IL-31 Reporter Cell Line H_IL-31 Reporter DDX35TM Cell Line
Cynomolgus_IL31RA CHO-K1 Cell Line H_IL31RA CHO-K1 Cell Line H_IL31RA HEK-293 Cell Line
H_IL-31RA OSMR Baf3 Cell Line
Anti-IL31 hIgG1 Antibody(mAb33) Anti-IL-31 hIgG4 Reference Antibody (BMS-981164) Anti-IL31RA hIgG1 Antibody(NA633)
Anti-IL31RA hIgG2 Antibody(Nemolizumab) Anti-IL31RA hIgG2 Reference Antibody (Nemobio) Anti-IL-4R×IL31 hIgG4 Reference Antibody (PRO2198)
Anti-OSMR hIgG4 Antibody(Vixarelimab) Anti-OSMR hIgG4 Reference Antibody (Vixabio)
Cynomolgus IL-31 Protein; His Tag Human IL-31 Protein; His Tag Human IL-31RA Protein; hFc Tag
MRGPRX2
H_MRGPRX2 Gqi5 Reporter CHO-K1 Cell Line Tango-H_MRGPRX2 CHO-K1 Cell Line Cynomolgus_MRGPRX2 CHO-K1 Cell Line
Cynomolgus_MRGPRX2 HEK-293 Cell Line Flag-Mouse_Mrgprb2 CHO-K1 Cell Line Flag-Rat_Mrgprb3 HEK-293 Cell Line
H_MRGPRX2 CHO-K1 Cell Line H_MRGPRX2 HEK-293 Cell Line H_MRGPRX2 HMC-1 Cell Line
H_MRGPRX2 RBL-2H3 Cell Line    
Mouse_OX40L CHO-K1 Cell Line
Cat. No.
GM-C36301
Size
1 Tube
Quote
Specifications
Data Display
Materials
Cell Culture
Sequence
Related products
Specifications
Cat. No GM-C36301
Product Mouse_OX40L CHO-K1 Cell Line
Description Mouse_OX40L CHO-K1 Cell Line is a clonal stable CHO-K1 cell line that constitutively expresses the mouse OX40L gene, constructed using lentiviral technology.
Product Format 1 vial of frozen cells
Quantity 5E6 Cells per vial,1 mL
Storage Conditions Liquid nitrogen immediately upon receipt
Target Mouse_OX40L
Gene ID/Uniprot ID P43488
Host Cell CHO-K1
Recovery Medium F12K+10% FBS+1% P.S
Growth medium F12K+10% FBS+1% P.S+4 μg/mL Puromycin
Note None
Freezing Medium 90% FBS+10% DMSO
Growth properties Adherent
Growth Conditions 37°C, 5% CO₂
Safety considerations Biosafety Level 2
Mycoplasma Testing The cell line has been screened to confirm the absence of Mycoplasma species.
Data Display
Expression
Mouse_OX40L CHO-K1 Cell Line (Cat. GM-C36301) was determined by flow cytometry using APC anti-mouse CD252 (OX40L) Antibody (biolegend/108811).
Materials
Reagent Ordering Information
F12K BOSTER/PYG0036
Fetal Bovine Serum ExCell/FSP500
Pen/Strep Thermo/15140-122
Puromycin Genomeditech/GM-040401
APC anti-mouse CD252 (OX40L) Antibody biolegend/108811
Cell Culture

Cell Recovery

Recovery Medium: F12K+10% FBS+1% P.S

To insure the highest level of viability, thaw the vial and initiate the culture as soon as possible upon receipt. If upon arrival, continued storage of the frozen culture is necessary, it should be stored in liquid nitrogen vapor phase and not at -70°C. Storage at -70°C will result in loss of viability.

a)       Thaw the vial by gentle agitation in a 37°C water bath. To reduce the possibility of contamination, keep the O-ring and cap out of the water. Thawing should be rapid (approximately 2 - 3 minutes).

b)       Remove the vial from the water bath as soon as the contents are thawed, and decontaminate by dipping in or spraying with 70% ethanol. All of the operations from this point on should be carried out under strict aseptic conditions.

c)       Transfer the vial contents to a centrifuge tube containing 5.0 mL complete culture medium and spin at approximately 176 x g for 5 minutes. Discard supernatant.

d)       Resuspend cell pellet with the recommended recovery medium. And dispense into appropriate culture dishes.

e)       Incubate the culture at 37°C in a suitable incubator. A 5% CO₂ in air atmosphere is recommended if using the medium described on this product sheet.

Cell Freezing

Freezing Medium: 90% FBS+10% DMSO

a)          Centrifuge at 176 x g for 3 minutes to collect cells.

b)         Resuspend the cells in pre-cooled freezing medium and adjust the cell density to 5E6 cells/mL.

c)          Aliquot 1 mL into each vial.

d)         Place the vial in a controlled-rate freezing container and store at -80°C for at least 1 day, then transfer to liquid nitrogen as soon as possible.

Cell passage

Growth medium: F12K+10% FBS+1% P.S+4 μg/mL Puromycin

For the first 1 to 2 passages post-resuscitation, use the recovery medium. Once the cells have stabilized, switch to a growth medium.

a)          Remove and discard culture medium.

b)         Briefly rinse the cell layer with PBS to remove all traces of serum that contains trypsin inhibitor.

c)          Add 1.0 mL of 0.25% (w/v) Trypsin-EDTA solution to dish and observe cells under an inverted microscope until cell layer is dispersed (usually within 2 to 3 minutes at 37°C).

d)         Note: To avoid clumping do not agitate the cells by hitting or shaking the flask while waiting for the cells to detach. Cells that are difficult to detach may be placed at 37°C to facilitate dispersal.

e)          Add 2.0 mL of growth medium to mix well and aspirate cells by gently pipetting.

f)          After centrifugation, resuspend the pellet and add appropriate aliquots of the cell suspension to new culture vessels.

g)         Incubate cultures at 37°C.

Subcultivation Ratio: A subcultivation ratio of 1:4 - 1:5 is recommended

Medium Renewal: Every 2 to 3 days

Notes

a)          After the stabilization of the cell condition, there will be fewer dead cells post-passage, the cell growth rate will tend to stabilize, cell morphology will become uniform, and the cells will appear robust.

Sequence

OX40L P43488 1995-11-01 v1
MEGEGVQPLDENLENGSRPRFKWKKTLRLVVSGIKGAGMLLCFIYVCLQLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL

Related products
OX40:OX40L
H_OX40 Reporter Cell Line H_OX40 Reporter DDX35TM Cell Line Cynomolgus_OX40L CHO-K1 Cell Line
H_OX40 CHO-K1 Cell Line H_OX40L CHO-K1 Cell Line H_OX40L HEK-293 Cell Line
Anti-H_OX40 hIgG2 Antibody(Ivuxolimab) Anti-OX40L hIgG1 Reference Antibody(Oxebio) Anti-OX40L hIgG4 Antibody(Amlitelimab)
Anti-OX40L hIgG4 Reference Antibody(Amlbio)
Biotinylated Human OX40L Protein; His-Avi Tag Cynomolgus OX40 Protein; His Tag Cynomolgus OX40L Protein; His Tag
Cynomolgus OX40L Protein; mFc Tag Human OX40 Protein; His Tag Human OX40L Protein; His Tag
Human OX40L Protein; mFc Tag    
IL-4/IL-13
IL-4 Reporter Cell Line IL-4/IL-13 Reporter 293 Cell Line IL-4/IL-13 Reporter 293 DDX35TM Cell Line
Cynomolgus_IL4R CHO-K1 Cell Line H_IL4R CHO-K1 Cell Line H_IL4R CHO-K1 Cell Line (Low Expression)
H_IL4R HEK-293 Cell Line Mouse_IL4R CHO-K1 Cell Line
Anti-IL13 hIgG4 Reference Antibody (Lebribio) Anti-IL-4R hIgG1 Antibody(12B5) Anti-IL4R hIgG4 Antibody(Dupilumab)
Anti-IL4R hIgG4 Reference Antibody (Dupbio) Anti-IL-4R×IL31 hIgG4 Reference Antibody (PRO2198) Anti-Mouse IL-4RA mIgG1 Antibody
Biotinylated Human IL-4R alpha Protein; Avi-His Tag Cynomolgus IL-13 Protein; His Tag Cynomolgus IL-4R alpha Protein; His Tag
Human IL-13 Protein; His Tag Human IL-13RA1 Protein; His Tag Human IL-4 Protein; His Tag
Human IL-4R alpha Protein; hFc Tag Human IL-4R alpha Protein; His Tag Human IL-4R alpha Protein; mFc Tag
Mouse IL-13 Protein; His Tag Mouse IL-4R alpha Protein; His Tag Rat IL-4R alpha Protein; His Tag
IL-31
Cynomolgus_IL-31RA OSMR Reporter Baf3 Cell Line H_IL-31 Reporter Cell Line H_IL-31 Reporter DDX35TM Cell Line
Cynomolgus_IL31RA CHO-K1 Cell Line H_IL31RA CHO-K1 Cell Line H_IL31RA HEK-293 Cell Line
H_IL-31RA OSMR Baf3 Cell Line
Anti-IL31 hIgG1 Antibody(mAb33) Anti-IL-31 hIgG4 Reference Antibody (BMS-981164) Anti-IL31RA hIgG1 Antibody(NA633)
Anti-IL31RA hIgG2 Antibody(Nemolizumab) Anti-IL31RA hIgG2 Reference Antibody (Nemobio) Anti-IL-4R×IL31 hIgG4 Reference Antibody (PRO2198)
Anti-OSMR hIgG4 Antibody(Vixarelimab) Anti-OSMR hIgG4 Reference Antibody (Vixabio)
Cynomolgus IL-31 Protein; His Tag Human IL-31 Protein; His Tag Human IL-31RA Protein; hFc Tag
MRGPRX2
H_MRGPRX2 Gqi5 Reporter CHO-K1 Cell Line Tango-H_MRGPRX2 CHO-K1 Cell Line Cynomolgus_MRGPRX2 CHO-K1 Cell Line
Cynomolgus_MRGPRX2 HEK-293 Cell Line Flag-Mouse_Mrgprb2 CHO-K1 Cell Line Flag-Rat_Mrgprb3 HEK-293 Cell Line
H_MRGPRX2 CHO-K1 Cell Line H_MRGPRX2 HEK-293 Cell Line H_MRGPRX2 HMC-1 Cell Line
H_MRGPRX2 RBL-2H3 Cell Line    
Message consultation
reset
submit
Message
Message consultation
reset
submit